KEGG   Xenopus tropicalis (western clawed frog): 100335084
Entry
100335084         CDS       T01011                                 

Gene name
t2r35
Definition
(RefSeq) bitter taste receptor 35
  KO
K08474  taste receptor type 2
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xtr04030]
    100335084 (t2r35)
G protein-coupled receptors [BR:xtr04030]
 Others
  Chemoreception
   Taste
    100335084 (t2r35)
SSDB
Motif
Pfam: TAS2R Tad
Other DBs
NCBI-GeneID: 100335084
NCBI-ProteinID: NP_001165492
UniProt: Q2AB50
Position
9
AA seq 304 aa
MDLSRILKIVFQLPQNLADMTGAFTNAYISFVILLDYFKTQTMSTSNKILLALSLSNVFL
SLILFVSAVSVFWPEIYADYYVKAYIFALLLFGICSSVWNTTCLCVFYFLKIINFGSGIL
AFFKIKINVMVPWFIFFSEALSLGCSFITLLPSVNSPGSSSNTSLVYSLNSTSVDIASIP
GFMKVTFIVAFVPLLIMLVTTFSTMGSLYLHSRRMENTGTSSSVAPHRSAVFMMAWLLLL
YAVVFVALFTYFFKLFDSKSFGYWITYMLLYSFTLVQSIVLILGNPKLKEAITICCCLFA
TKVN
NT seq 915 nt   +upstreamnt  +downstreamnt
atggatttatctaggatactaaaaattgtgtttcagcttccacaaaacctggctgacatg
acaggagccttcactaatgcctatatctcttttgtgattttgcttgactattttaaaaca
caaacgatgagcaccagcaataagatattacttgccctgagcttatccaatgtttttctt
tctcttattttattcgtttccgcggtgagtgttttctggccggagatatatgcagattat
tatgtcaaggcctatatttttgcactgctcctgtttggcatttgttcctccgtctggaat
accacctgtctctgtgtcttctactttttgaaaataatcaacttcggctctggcattctt
gctttcttcaagataaagatcaacgtcatggttccatggttcatattcttttcagaagca
ttgtctttaggctgcagtttcattacattattgccttctgtcaatagcccaggatcttca
tcaaacacctcattggtctactcactcaactccacatcagtagatattgccagcatccct
ggattcatgaaggttaccttcattgttgcttttgtccctttgctgattatgcttgtcact
accttctctacaatggggtcactttatttgcacagtcggagaatggagaacacagggaca
tctagcagtgtggcccctcatcgaagtgctgtgtttatgatggcatggctccttctttta
tatgctgttgtttttgttgcattgtttacgtatttcttcaagctctttgattcaaaaagc
tttggatattggataacttatatgctgttatattcattcactttagtacaatccatcgtt
ctaattctgggtaaccctaaactaaaagaagcaataactatatgttgctgtttatttgcc
acaaaagtaaactag

DBGET integrated database retrieval system