KEGG   Xenopus tropicalis (western clawed frog): 100335094
Entry
100335094         CDS       T01011                                 

Gene name
t2r47
Definition
(RefSeq) bitter taste receptor 47
  KO
K08474  taste receptor type 2
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xtr04030]
    100335094 (t2r47)
G protein-coupled receptors [BR:xtr04030]
 Others
  Chemoreception
   Taste
    100335094 (t2r47)
SSDB
Motif
Pfam: TAS2R 7tm_1
Other DBs
NCBI-GeneID: 100335094
NCBI-ProteinID: NP_001165501
UniProt: Q2AB40
AA seq 291 aa
MLSELHLIFSIGLVLSWICGTVLNSSIVAVYLSDWKKGLNLGACNQIILTMGCTNLLLQS
FLTFHLMFITYQFSVLLDKELLLAAVSFGLHFSISLSFWLTAWLSGYYCVKLANSSNRFF
IRLKREVSTVVAYCLLGTVLTLFIAEMPVIWTTHIITDQNQTSIYCIMDDNIALVSFNFT
ISCLLPTIMTSFCIGLSLISLLKHVHKMKQNTSQFWNPQLKSHVKACRTMLLLLAVNLIF
SLAVFISSQPTDKAEVIGVYVPWFILMSYPSAKAIILLFGQSSCFLSKRVI
NT seq 876 nt   +upstreamnt  +downstreamnt
atgctctcagaactccacttgattttcagcattggtcttgttctatcatggatatgtggg
accgtcctaaactcatccattgtagccgtgtatctcagtgactggaagaagggattgaac
cttggtgcctgcaatcaaatcattctcaccatgggttgcaccaacctactcctgcagagc
ttcttaacatttcatctgatgttcataacttatcagttctccgttctgcttgacaaagaa
ttacttttagccgctgtctcttttggtttacacttttcaatttctctctcattttggctc
actgcctggctcagcggctactactgtgtaaaactggccaactcctccaacagattcttc
attcgattaaaaagagaagtttctactgtggttgcctactgcctactgggaacagtgctt
actctgttcattgctgaaatgcccgttatttggacaacgcatataataacagaccaaaat
caaacaagcatttattgtattatggatgataatattgcacttgtttcatttaacttcaca
atttcttgcctccttccaactattatgacgtccttttgtattggactcagcctgatctcc
cttctgaaacacgtccataagatgaagcagaatacttctcagttttggaaccctcagctg
aaaagccatgtaaaggcctgcaggacaatgctacttctgttggctgtgaacttgatattc
tcattggctgtttttatttcctcccagccgacagataaggctgaagttattggggtatat
gtaccctggtttattttgatgtcatatccctcagctaaagccataattcttctctttggt
caaagttcttgttttctcagtaaaagggtcatatga

DBGET integrated database retrieval system