KEGG   Xenopus tropicalis (western clawed frog): 100380064Help
Entry
100380064         CDS       T01011                                 

Gene name
acox3
Definition
(RefSeq) acyl-CoA oxidase 3, pristanoyl
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00071  Fatty acid degradation
xtr00410  beta-Alanine metabolism
xtr00592  alpha-Linolenic acid metabolism
xtr00640  Propanoate metabolism
xtr01040  Biosynthesis of unsaturated fatty acids
xtr01100  Metabolic pathways
xtr01200  Carbon metabolism
xtr01212  Fatty acid metabolism
xtr03320  PPAR signaling pathway
xtr04146  Peroxisome
Module
xtr_M00087  beta-Oxidation
xtr_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    100380064 (acox3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100380064 (acox3)
   00592 alpha-Linolenic acid metabolism
    100380064 (acox3)
   01040 Biosynthesis of unsaturated fatty acids
    100380064 (acox3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100380064 (acox3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100380064 (acox3)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100380064 (acox3)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     100380064 (acox3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_ox_N
Motif
Other DBs
NCBI-GeneID: 100380064
NCBI-ProteinID: XP_002938687
Xenbase: XB-GENE-991919
Position
1
AA seq 706 aa AA seqDB search
MNTAKGTTSQRPNIPNELLPDLPHGPLSEYRRRASFNWKEMVFFLDDEELIQFKKEIFSA
LENDPLFHRHPGQDLCMEKYRELTFRRCKRIFEYNFLTLQQTLEKPQKVLALINCLGMYD
WSLGAKYFLNTQVFSGAVGNAGSERHSQFLNQVQTMEIFGCFALTELSHGSNTKAVRTTA
TFDASTKGFILNSPDFEAAKFWVGNMGKTATHAVVYAQLYTSDGKCHGLHSFVVQIRDPQ
TLLPMPGVMVGDIGKKLGQNGLDNGFAMFHNVRIPQENLLNRTGEITSSGTYTSAYKDPK
QRLGASLGTLSSGRVSIMSMAVVNLKLAISIAIRFSATRRQFGPTEDEEIPVLEYQLQQW
RLIPYLAAAYALDYFSKTFFMNLVELQIGIFMKDKSQRQAELGKEIHALSCAGKPLASWT
AQHGAQECREACGGHGYLAMNRLGDIRSDNDPNCTYEGDNNVLLQQTSNYLLSLVHLVHE
DKAHIESPLGSINFLIDFKDILGHKFTASSVEECLDPKVSLAAYKWLVCYLLRESYLKLQ
QEKKNRNNDFNARNNCQVYYCRSLALAFIEHAVLERFHDYTHDFSTPSSLQPVLKKLCAL
YGLWSLSKHLTVLYQGGYCLGQLPARIVQDAILELCAQLKDEAVALVDVIAPPDFILNSP
IAKADGELYKNLWSAVLQGEKVLERASWWEEFCSNKPVIEPLKSQL
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgaacactgccaaaggcaccacatcacagcgcccaaatattccgaatgagttgcttcca
gatttacctcatgggcctctctcagaatatagaagaagagcgtcttttaattggaaggaa
atggtattttttttggatgatgaagaacttatccagtttaagaaggaaatcttctctgct
ctagagaatgacccactgttccatcgacatcctggacaagacttgtgtatggagaagtac
agagagctgacattccgacggtgcaagaggatttttgaatataacttcctgactctgcaa
cagactttggagaagccacagaaagtgttagctctcataaattgcttgggcatgtatgat
tggtcacttggagcgaaatatttcctgaacactcaggtgttcagtggtgctgttggaaat
gctggatctgaaaggcacagccagtttttaaatcaagtacaaacaatggagatttttggg
tgctttgcattgactgaactcagtcatggcagtaacacaaaagctgtaagaacaacggca
acatttgatgcatctaccaagggatttattctgaactcgccagattttgaagctgccaag
ttttgggtgggcaacatgggaaagaccgctacccatgcagtcgtttatgctcagctctat
acctctgatggaaagtgccatgggttacattcctttgttgtgcagatacgggaccctcag
actcttctgcccatgcctggagtgatggtgggggacataggcaagaaacttggccagaat
ggtttagacaatggatttgctatgtttcacaatgttcgaattcctcaagaaaacctcttg
aaccgcactggcgagatcacatcaagtgggacctacacaagtgcttataaggatcctaag
caacgtcttggcgcttctctcggaaccttatctagcggaagggtttcaatcatgagcatg
gctgtagtgaacctgaaacttgccatttccatagcaattcgtttctcagcaacccgtcgg
cagtttggccccacagaagatgaagagataccagtgctggaatatcaactgcagcaatgg
cgacttatcccttatctggccgctgcatatgctcttgactatttctcaaagaccttcttc
atgaatttggtagaacttcagattggtatctttatgaaggataagagtcaaagacaggct
gaacttggcaaggagattcatgctttgtcctgtgccggtaaacccctggcctcttggact
gctcagcacggggcacaggaatgtcgggaagcctgcggaggtcatggctatctagctatg
aaccgattaggagacatccgcagcgacaatgacccgaactgcacatacgaaggcgacaac
aacgttctgcttcagcagactagcaactacttacttagcttggtgcatttagtccatgaa
gacaaggctcacattgagtcccctctgggatccattaactttctcatcgacttcaaagat
attttgggacataagtttacagcaagctctgttgaagaatgtctggatcccaaagtttcc
ctggcggcctacaagtggttggtctgttatctcctacgtgaaagttacctgaaattgcag
caggaaaagaaaaataggaataatgattttaatgcaagaaacaactgtcaggtctactat
tgtcgttccttagccctggccttcattgagcatgctgtgctggagagattccatgattat
acccacgatttcagcacaccctcctccctacagccagtcctgaagaagctgtgtgcattg
tatggcctgtggtccctaagtaaacatttgacagtcctctaccaaggaggatactgctta
gggcaactgcctgcaaggattgtacaagacgctatcctggagctttgtgcacagcttaaa
gacgaggccgtcgctctagtggatgttattgctcctccagacttcattttaaactcacct
attgccaaagccgatggagagctgtataaaaatctgtggtctgcggtgctgcaaggagag
aaggtgctggagagggcatcttggtgggaggaattctgcagcaacaaaccggttatcgag
ccgctcaaatcacagctgtaa

DBGET integrated database retrieval system