KEGG   Xenopus tropicalis (western clawed frog): 100485430Help
Entry
100485430         CDS       T01011                                 

Gene name
jmjd7-pla2g4b, pla2g4d
Definition
(RefSeq) JMJD7-PLA2G4B readthrough
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00564  Glycerophospholipid metabolism
xtr00565  Ether lipid metabolism
xtr00590  Arachidonic acid metabolism
xtr00591  Linoleic acid metabolism
xtr00592  alpha-Linolenic acid metabolism
xtr01100  Metabolic pathways
xtr04010  MAPK signaling pathway
xtr04217  Necroptosis
xtr04270  Vascular smooth muscle contraction
xtr04370  VEGF signaling pathway
xtr04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100485430 (jmjd7-pla2g4b)
   00565 Ether lipid metabolism
    100485430 (jmjd7-pla2g4b)
   00590 Arachidonic acid metabolism
    100485430 (jmjd7-pla2g4b)
   00591 Linoleic acid metabolism
    100485430 (jmjd7-pla2g4b)
   00592 alpha-Linolenic acid metabolism
    100485430 (jmjd7-pla2g4b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100485430 (jmjd7-pla2g4b)
   04370 VEGF signaling pathway
    100485430 (jmjd7-pla2g4b)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100485430 (jmjd7-pla2g4b)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100485430 (jmjd7-pla2g4b)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100485430 (jmjd7-pla2g4b)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100485430 (jmjd7-pla2g4b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2 cPLA2_C2
Motif
Other DBs
NCBI-GeneID: 100485430
NCBI-ProteinID: XP_017951914
Xenbase: XB-GENE-6050287
Position
8
AA seq 792 aa AA seqDB search
MGMPKVALPEEACVFELSVRIIQARNIHGSDTATNPDCYVCLQLPTALTERKRTKTIWNC
TDPVWDETFHFRIHSHIKNILDVSLHDEDINTGDDHLLTVSYDLGNVPLNKPVLENFTLN
KEKNEELQVEFNIVSIPETHKEVITNGVLVCPAMAELEVQVEKQKYKKKLELALTLLGSY
ENSHSLIIPKNDSSSNVKENFAFHYPRDWGMEFTATLNRVYPSVDVTFGKTLGIQLKMKE
CPENLDVRLGFNLCDKEKMFLYKRQRVVAEAMKKVLQIKEDLVGEEVPVVAIMATGGGAR
AMSCLYSHLFALKKMGLLDCVTYIAGASGSTWTMSNLYKNSDWSQNELLEFIQNAKEHVT
RTKTKTFSMERLKYYHKELRQAASEGQKTSFTDLWGLMIESMFHNGKNESKLSDQQAALQ
NGQNPLPIYLAINVKQHEISTLDFKEWCEFTPYEVGLQKYGASIRTEDFGSEFYMGRLMK
KHPEPRICYLQGLWGNVFSLNLIDTWYLTTQVETFWDQWGKDRTKDLDENELRERKESAQ
MKTHLFTPPSTFDSILKGILTNRPIDGAQENFLRGMHLHKDYHENSQFCTWRDTYLDSFP
NKLTPLEENLCLVDAGYFINASFPPLLKPERKVDIILSFDYTLETPLMAVEQTCKYCTTQ
GIGFPSVTLKEEEKSHHKECYCFVDDGNPHAPIVLHFPLVNDTFRKYKEPGVLRSEEEMP
EGDVDVSECSPYFLTNFTYTERDFDKLMKLTQYNIENNNSTILETMRTAIKRRKSKNPFN
EMQQIPVQTHKQ
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgcctaaagtagcactgcctgaagaggcatgtgtgtttgaattatctgtaagg
atcatacaagctcggaacatccatgggtcagacactgctaccaatccagattgctatgtg
tgtcttcagcttcccacagctcttacagaaaggaaaagaactaagaccatttggaattgt
acagatccagtgtgggatgaaacctttcacttcagaatccatagtcacataaaaaacatc
ctggacgtgtcactgcatgatgaagatatcaacactggagatgaccatcttctcactgtg
agctatgacctgggcaatgttccacttaacaaacctgtattggagaactttactctgaat
aaagagaaaaatgaagaacttcaggtagaattcaatattgtcagcataccagaaacacat
aaagaagttattactaatggagtattagtgtgccctgcgatggctgaacttgaagtccaa
gtagagaaacaaaagtataaaaagaaattagagctggcactaacactgttgggctcttat
gagaactcacacagcctaatcattcctaaaaatgatagcagttccaatgtgaaggaaaac
ttcgcctttcattacccgagagactggggaatggaattcacagccaccttgaacagagtg
tacccatctgtggatgtcacttttggcaagactttgggaattcagcttaaaatgaaagaa
tgtccagagaatcttgatgtccgtctgggcttcaatctatgtgataaggagaagatgttt
ctctataagagacaaagggtagtagctgaggcaatgaagaaagttcttcagataaaagaa
gatttggttggagaggaggttcctgttgtggctatcatggcgacaggaggaggagctcga
gctatgtcttgtctctacagtcatctgtttgctttaaagaagatgggccttttggattgt
gtcacatatattgcaggggcttctggatcaacatggacaatgagtaatctttataagaat
tctgactggtcacagaatgagctgttggaatttattcagaatgcaaaggaacatgtcacc
agaacaaaaacaaagacattttccatggagcgtctgaaatactatcacaaagagctgcga
caagcagccagcgagggccagaaaacctcttttacagatttatggggcttaatgattgaa
tcaatgttccacaatgggaagaatgagagcaagctttctgatcagcaagctgcgcttcaa
aatggccagaaccctctacctatttatttagcaatcaacgttaagcagcatgaaattagt
acattggatttcaaagaatggtgtgaatttactccatatgaagtggggctacaaaagtac
ggtgcctcaatccgcactgaggactttgggagtgagttttacatggggaggctgatgaag
aagcacccagagccccgtatctgctacttgcaaggcttgtggggaaatgtattctctttg
aatctaatagacacctggtatctcaccacacaagtggaaaccttctgggatcaatgggga
aaagacagaaccaaagatttagatgagaatgaactaagagaaaggaaggaatcagcacaa
atgaaaactcacctgtttacccctccaagcacctttgattctattctaaaaggaatatta
accaacaggccaattgatggggcgcaagagaactttcttagaggaatgcacttacacaag
gactatcatgagaattcacagttttgcacatggagagatacatatttagattcctttccc
aacaagctcaccccactggaagagaatttgtgccttgtggatgctggttacttcatcaat
gccagctttcctcctcttctaaaaccagaaaggaaggtggacatcatcttatcttttgac
tacactctagaaacaccactcatggcagtagaacagacctgcaaatattgtactacacaa
ggtattggcttccctagtgtaacactgaaagaggaagaaaagagtcaccataaagagtgc
tattgttttgtagacgatggcaaccctcatgcacccatagtcctccactttccccttgtg
aacgacacctttagaaaatacaaagaacctggtgttctacgatcagaggaagagatgcct
gaaggagatgtggatgtttctgagtgttccccctattttttgacaaactttacctatact
gaacgtgactttgacaagctgatgaaattgactcagtacaatattgagaacaacaacagc
actattctggagaccatgcgtacagctataaagagacggaagtccaagaatccttttaac
gaaatgcagcaaataccagtgcaaactcacaaacaataa

DBGET integrated database retrieval system