KEGG   Xenopus tropicalis (western clawed frog): 100485534Help
Entry
100485534         CDS       T01011                                 

Definition
(RefSeq) probable beta-D-xylosidase 5
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00500  Starch and sucrose metabolism
xtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100485534
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     100485534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like
Motif
Other DBs
NCBI-GeneID: 100485534
NCBI-ProteinID: XP_002936263
Position
2
AA seq 746 aa AA seqDB search
MAKISLLTASLVLLNLAVFLGQQYPFMDPSLPWDKRVTDLISRLTLEEMVLQISRGGVQQ
NGPAPPIPRLGVKPYSWNTECLRGDAQAPGWATSFPQALGLAATFSPQLVARVANATATE
VRAKHNYFMSVGNYDDHTGLSCFSPVINIMRHPLWGRNQETYGEDPYLTGLLATAFVKGL
QGDHPRYIKANAGCKHFAAHGGPENVPVSRFSFDAKVEERDLQMTFLPQFHECVQAGTYS
IMCSYNRVNGVPACANKRLLTDILRTEWGFNGYVVSDEGAIEYIMEKHKYTSSFLETAVE
ALNSGCNLELSINLADNVFMKVQDAVKFGNITIETLKERLYPLFYTRMRLGEFDPPEMNP
YSSLDLRSVQSKEHRDLALEAAIKSFVLLKNTRNTLPLSLQSITGKKIGIIGPFADDPMG
LFGDYEPHPDSQYISTPRGGITMLPVQVSFAAGCSDARCEKYSPEEIKQLVKSVDITVVC
LGTGITVETEGSDRQDLSLPGHQADLLKDAVTSAAGHPVILLLFNAGPLDVSWAKSNDGV
HAILECFFPAQAAGIAIAKLLVGADGVSPAGRLPATWPSGMEQVPPMENYTMQGRTYRYY
GNQMPLYPFGYGLSYTNFHYSELIMNSSLGTCDILHLSVQVQNNGSRAGEEVVQVYISWV
FASVPVPGWQLVGTEKVTIPAAASVKVSFSILPKQRAVWTDLWMLEPMVFQLYVGGQQPF
QDTQAPSNILQGSFIVVGLPQPLSTC
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagataagccttctgactgcatccctagttttgctaaaccttgcagtattcctt
gggcagcaataccccttcatggacccatcactgccatgggataaacgagttacggatctg
atttcgcggctgactcttgaagagatggttcttcagatatctaggggtggagtacagcag
aatggacccgcacctcccatcccacggctaggagtgaaaccctattcatggaacacagaa
tgcctaagaggtgatgcccaggcacctggttgggccacatcctttccacaagccctggga
ttggctgcaactttcagtcctcagttggtggctcgtgtggctaatgccactgctactgaa
gtaagagccaaacacaactacttcatgtctgtcggaaattatgatgaccacactggactt
agttgcttcagccctgtgataaatatcatgaggcaccctttgtgggggagaaatcaggaa
acctatggtgaagatccctatttaactggtcttctagccacagcctttgttaagggactt
cagggagaccatcctcggtatattaaagctaatgcaggctgcaaacactttgctgcccat
ggtggcccagaaaatgttcctgtttccagattcagctttgatgccaaggtagaggagaga
gatctgcagatgacttttctgccacagtttcatgagtgtgttcaagctggcacctatagc
atcatgtgtagctataacagggtgaatggggtccctgcctgtgccaacaaaaggcttctt
acagacatacttcgcacagaatggggtttcaatggttatgtagtgagtgatgaaggtgct
attgaatatataatggaaaaacacaagtatacaagcagcttcttggaaacagcagtggag
gctctaaattctggatgcaacctggagctgtccatcaatctagcagataatgttttcatg
aaagtccaggatgctgtgaagtttggcaacatcaccatagagaccttaaaggagcggctt
tacccactgttttacacccgcatgcgtttaggagagtttgatccacccgagatgaatcct
tacagctcgctggatctccgttctgttcagagcaaagaacatcgagatcttgcattggaa
gctgctatcaagagttttgtgttgttaaaaaacaccagaaacactttgccactaagtctg
cagtcaatcacaggaaagaaaattgggattattggcccttttgctgatgatcctatgggt
ctttttggagattatgaaccccatcctgactctcaatatatatccactcccaggggtggc
ataacaatgcttccagtacaagtgagctttgctgcaggatgcagtgatgcgcggtgtgaa
aagtactctcctgaagagataaagcagttggtgaagtctgtagatataacagttgtgtgt
cttggtacaggtattactgtagagacagagggaagtgatcggcaagacctctcattgcct
ggccaccaggccgatcttctaaaggatgctgtgacatcagctgcaggtcatccagtcatt
ctgctgctatttaatgctggtcctctggatgtttcctgggcaaagagcaatgatggggtt
catgccatacttgagtgcttcttccctgcacaggctgcaggcattgccattgcaaagctg
ctggtaggcgctgatggtgtgagccccgcaggcagactgccagcaacatggccatctggg
atggaacaggtgcctccgatggagaattacacaatgcagggaagaacataccgctattat
gggaatcagatgccactctatccttttggatatgggctttcctataccaattttcattac
agtgaactcataatgaacagttccctgggcacatgtgacatacttcacttgtctgtgcaa
gtgcagaataatggcagcagagctggggaggaggtggtacaagtgtacattagctgggtt
tttgcctctgttcctgttcctggttggcaacttgtgggaacggaaaaggtgaccattcca
gctgctgcttctgtgaaggtctcattttctatccttccaaaacagagagcggtttggact
gacctatggatgcttgagcctatggtttttcaactctatgttggtggacagcagcctttt
caagacacgcaagccccatccaacattcttcaaggcagcttcattgtggtagggctgccc
cagcccctcagcacttgctaa

DBGET integrated database retrieval system