KEGG   Xenopus tropicalis (western clawed frog): 100485757
Entry
100485757         CDS       T01011                                 

Symbol
mrps14
Name
(RefSeq) 28S ribosomal protein S14, mitochondrial
  KO
K02954  small subunit ribosomal protein S14
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    100485757 (mrps14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:xtr03011]
    100485757 (mrps14)
Ribosome [BR:xtr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    100485757 (mrps14)
  Bacteria
    100485757 (mrps14)
  Archaea
    100485757 (mrps14)
SSDB
Motif
Pfam: Ribosomal_S14
Other DBs
NCBI-GeneID: 100485757
NCBI-ProteinID: XP_002931484
Xenbase: XB-GENE-975794
UniProt: A0A7D9NKW4 F6XK08
Position
4
AA seq 131 aa
MAASMLGSVFRSARQLFPWPSATCTNQVRNYYVDWRMFRDVKRRKMAYEYADERLRVNAL
RKNIILPKELREVADKEIAAFPVDSCPVRIRNRCVLTSRPRGVKRRWRLSRIVFRHLADN
NQMSGIQRAMW
NT seq 396 nt   +upstreamnt  +downstreamnt
atggcggcttccatgctggggagtgtgtttcgaagcgctcggcagttgtttccttggcct
tctgcaacttgtacaaatcaagtccgaaattactacgttgactggaggatgtttcgggat
gttaaaaggaggaaaatggcatatgaatacgctgatgagagattgagagtcaatgctttg
cggaaaaacattattctccctaaagaactgcgggaagtggcagataaagaaattgctgca
tttccagtagatagctgccctgtaagaatccgtaatcgctgtgtcctgacttctcgacca
cggggtgtaaaaagacgttggcggctaagtcgaattgtgttccgtcatctagccgataac
aaccaaatgtctggcattcagagagccatgtggtag

DBGET integrated database retrieval system