KEGG   Xenopus tropicalis (western clawed frog): 100485851Help
Entry
100485851         CDS       T01011                                 

Gene name
mtmr7
Definition
(RefSeq) myotubularin related protein 7
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00562  Inositol phosphate metabolism
xtr01100  Metabolic pathways
xtr04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100485851 (mtmr7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100485851 (mtmr7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xtr01009]
    100485851 (mtmr7)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     100485851 (mtmr7)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     100485851 (mtmr7)
Protein phosphatases and associated proteins [BR:xtr01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    100485851 (mtmr7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related DSPc GRAM Y_phosphatase Vps36_ESCRT-II Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 100485851
NCBI-ProteinID: XP_004911249
Xenbase: XB-GENE-1008662
Position
1
AA seq 657 aa AA seqDB search
MEHIRLPKVENVRLLDRISSRKAALGTLYLTGTHIIFVENISETRKETWILYSQISSIEK
QATATSGCPILIHCKNFQVIQLIIPQERDCHDIYLSLVRLSRPVKYEELYCFSFKPNLDK
TEHEEGWKLVDLNEEYNRMGLPKSLWQMSDVNRDYRVCDSYPTELYVPKSATVPIIVGSS
KFRSRGRFPTLSYYCQDNNASICRSSQPLSGFSARCLEDEQMLQAIRKANPGSDFLYVVD
TRPKLNAMANRAAGKGYENEDNYSDIKFQFIGIENIHVMRNSLQKMLEVCELRSPSMGDF
LWGLESSGWLKHIKAIIDAGIFIAKAVSEEGASVLVHCSDGWDRTAQVCSIASLLIDPYY
RTIKGFMVLIEKDWISFGHKFNHRYGNLDGDPKEVSPVIDQFIECVWQLMEQFPCAFEFN
ERFLVHIHHHVYSCQYGNFLCNCQKERREIRVQERTYSLWSYLWKQRLDYMNPLYRADHS
QTQGTLRPNTSPSNFKFWRGLYNRFEKGMQPRQSVTDFLQAVKEETQQLEEELEFMQKRW
QKFESQHLNGTKSFNEIHESDKLQICATAYTSANSPQDYSSTLKSFPSRSPSQGEEDSAL
ILTQEHLKSSDPDLSANSDQESGVEDLSCRSPSGGDSLPSEDSGKDPDSDEAMFLNA
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atggagcacatcaggcttcccaaggttgaaaatgtccgtttacttgaccgtatatcctcc
aggaaagctgcattggggaccttatatctgacaggaacccacatcatttttgtggaaaat
atatctgaaacacgtaaagaaacttggatcctttacagccagatctcttctattgaaaaa
caagcaactgcaaccagtggctgtcccatacttatccactgcaaaaatttccaggttata
cagctcattatccctcaggaacgagattgccatgacatttatttatccttggtacgactg
tcaaggccagttaaatatgaggagctctattgcttttctttcaaaccaaatttggacaag
acagagcatgaagaaggttggaagctggttgacttgaatgaagaatacaatcgcatgggt
cttccaaaaagtctctggcagatgagtgatgtaaatcgcgattacagagtatgtgattca
taccctacagagctctatgttcccaaatctgccactgtgccaattatcgttggcagctca
aaattccggagcaggggaagatttcccacactttcatattactgccaagataacaatgct
tctatttgtcgaagtagtcagccattatctggcttcagtgcgcggtgccttgaggatgaa
cagatgctacaggctatacggaaggcaaatcctggaagtgatttcctttatgttgttgat
acacgaccaaagctcaatgcaatggcaaacagagcagcagggaaaggatacgagaatgaa
gacaactactccgatatcaaatttcagtttattggcatagaaaacatccacgtcatgagg
aacagcctgcaaaaaatgttggaagtttgcgagcttcgatctccttctatgggagacttt
ctttggggactggaatcatctggttggctaaagcacatcaaagcaattattgatgctggg
attttcattgcaaaggctgtgtcagaagaaggagccagtgttcttgtccattgctcagat
ggatgggaccggacagcccaggtttgctctattgccagtcttctaattgatccttattac
agaaccataaaaggattcatggttttaattgaaaaggactggatttcatttggtcataaa
ttcaatcacaggtatggaaatttggatggtgacccaaaagaagtatctccagtaatcgat
cagtttatagagtgtgtttggcaactgatggaacagttcccgtgtgcatttgagtttaat
gagaggtttctggttcacattcatcatcatgtttactcctgccaatatggcaacttccta
tgcaactgccaaaaggagaggagggaaattagagtccaagaaagaacctactcactttgg
tcgtacttgtggaagcagcgcctggactatatgaacccactgtaccgagcagatcacagt
cagacgcagggcaccctgaggccaaacacttccccctccaatttcaaattctggaggggt
ctctacaatcgatttgagaaaggcatgcaacctcgccagtctgtgactgacttcctccag
gcagtaaaagaagagacacaacaactagaggaggaactggagttcatgcaaaagagatgg
caaaaatttgagagccagcatttaaatggcacaaagagctttaatgaaatccatgaaagc
gacaaattgcagatctgtgctactgcttacacctctgctaacagtccccaggattatagc
agcaccctcaaatcctttccctcccgcagcccctcacagggtgaagaggattctgccctc
atccttactcaggaacacttgaagagctcagatccagatctgtctgcaaacagtgaccaa
gaatcaggcgtggaggatttaagttgtaggtcaccaagtggaggtgattcattaccaagt
gaagacagtggcaaagacccggattcagatgaagccatgttcctgaatgcttaa

DBGET integrated database retrieval system