KEGG   Xenopus tropicalis (western clawed frog): 100486741
Entry
100486741         CDS       T01011                                 

Definition
(RefSeq) uncharacterized protein LOC100486741
Organism
xtr  Xenopus tropicalis (western clawed frog)
SSDB
Motif
Pfam: FAD_binding_7 DNA_photolyase UIM
Other DBs
NCBI-GeneID: 100486741
NCBI-ProteinID: XP_002938187
Xenbase: XB-GENE-5887601
UniProt: A0A6I8QP63
Position
4
AA seq 862 aa
MDLEPFERAQIDDVLQQLESGSVQADEFLCLVLSILGSSRTYSQFPAILQSLSRKEPAMY
RELMDLHAEYFRKEPADLETLGYETDLELAIALSLQEHNQLTDTASFASEVDPAPKISFA
DAAKLSHFSHKHNKKNSSSKTEITKLKDNVAAMNLYQERKRYHINGQEKTCISNCYNGQP
EPEDCVLKSEDGEDVFHVETSRPRESKAKHSRRSRKKKKSAPSRGLVAMKPVLVWFRRDL
RLHDNPALISALEHGVPVIPVFLWCINEETGQNFTLATGGATKYWLHHALLKLNQSLIQR
FGSHIIFRVARSCEEELVSLVHETGADTIIINAVYEPWLKERDDLISETLRRHGVELKKH
HSYCLYEPDSVSTEGVGLRGIGSVSHFMSCCKRNNSAPIGMPLDAPRCLPAPCNWPESDH
LDTLELGKMPHRKDGTLIDWAVTIRESWDFSEDGAYTCLANFLQDGVKHYEKESGRADKP
YTSHISPYLHFGQISPRTVLHEAYFTKKNVPKFLRKLAWRDLAYWLLILFPDMPSEPVRP
AYKSQRWSSDLNHLRAWQKGLTGYPLVDAAMRELWLTGWMCNYSRHVVASFLVAYLHIHW
VHGYRWFQDTLLDADVAINAMMWQNGGMSGLDHWNFVMHPVDSALTCDPYGSYVRKWCPE
LAGLPDEYIHKPWKCAPSQLRRAGVILGRNYPHRIVLDLEERREQSLKDVVEVRKKHLEY
LDEVSGCDMVQIPDQLLALTLGHTSGEDEVVRNRTGSFLLPVITRKEFKYKTLQPDTKDN
PYNTVLKGYVSRKRDETIAYMNERHFTASTINEGAQRHERIERTNRLMEGLPAPSDAKNK
SRRTPKKDPFSIIPPSYLHLAN
NT seq 2589 nt   +upstreamnt  +downstreamnt
atggatttagagccattcgagcgggcacagattgacgatgttctgcagcagttggagagt
ggcagtgtgcaggctgacgagttcctctgcttggtcttgtccatactgggcagcagccgc
acttactcgcaattccctgctatcctgcagagcctcagtaggaaggagccggcaatgtac
agagaactgatggacttacacgctgagtatttccgcaaggagcctgctgacctggagaca
ctggggtatgagacagacttggaactagctattgccctgtctctacaggaacataatcaa
ctgacagacacagcttcatttgcttctgaagtggacccagctcctaaaatttcctttgca
gatgctgctaaattgtcacatttttcacataagcacaataaaaaaaattcctcctcaaag
actgaaattactaagttaaaagataatgtggctgcgatgaatctttaccaggaaagaaaa
cggtatcatattaatgggcaggagaagacttgtataagtaactgttataatggccagcct
gagccagaagattgtgtactaaaatctgaagatggtgaagacgttttccatgtagagact
tctaggccaagagagagcaaggctaagcatagcaggagaagccggaaaaaaaaaaagtct
gctccatcacggggtctggtagcaatgaaaccagttcttgtttggtttaggagagacctg
cgtttacatgataatccagcattaatttctgctcttgagcatggagtcccagtcatccct
gttttcctgtggtgcatcaatgaggaaactggacagaacttcacattggccactggaggg
gctaccaaatactggcttcaccatgccttactcaaactcaaccagagtctgatacagagg
tttggcagccacattatttttagggtggcccgttcatgtgaagaggaacttgtatctctt
gtgcatgaaacaggggcagacactatcataatcaatgctgtgtatgaaccatggctgaaa
gaaagagatgatcttatttcggaaaccttacgaagacatggggttgagcttaaaaaacac
cattcgtactgtctatatgaacctgattcagtcagtacagaaggggttggactcagagga
attggctccgtttcacatttcatgagctgctgtaagaggaacaactctgcaccaatcgga
atgccactagatgctccaaggtgtctccccgctccttgcaactggcctgaatctgatcat
ctagatacactggagttaggaaaaatgccacacaggaaagatggcactttgattgactgg
gctgtgactatcagggaatcctgggatttcagtgaagatggagcttatacatgtttagca
aacttcctacaagatggagtgaagcattatgagaaggaatctggccgtgcagacaaacct
tatacaagccatatctctccatatctccacttcgggcagattagtccccgcacagtattg
catgaagcttattttacaaagaagaatgtgcctaaatttctaaggaaacttgcttggaga
gacctagcgtattggctgctgatcctgttccctgacatgccctcagaacctgtcagacct
gcatataaaagtcagcgctggagcagtgatctaaatcatttaagggcatggcagaagggg
ctgactgggtatcctctggttgatgctgcaatgagagaactgtggcttactggttggatg
tgcaactactcaaggcatgtggttgcctcattcttggtagcttatctgcatatccattgg
gtacatggctacagatggttccaggacactttactggatgcagatgtggccattaatgca
atgatgtggcagaatgggggaatgtcagggttggatcactggaattttgtaatgcatcct
gtagattctgcactgacttgtgacccatatggctcatatgtgcggaagtggtgtccagaa
cttgctggcttgccagatgaatacattcacaagccatggaaatgcgcaccttctcaactt
cgacgtgcaggtgtaatccttggtcggaactatccccatcgtatagttctagacttagaa
gaaaggcgtgaacagtccttaaaagatgtagttgaagtccgaaagaagcatttggaatat
ttagatgaggtttcaggatgtgatatggttcagattcctgaccaactgttagcgcttact
ttgggacataccagtggtgaagatgaagttgtaagaaacagaacaggttcattccttttg
ccagtcatcacccgtaaggagttcaaatataaaacgctgcagcccgataccaaggataac
ccttacaacactgtactaaagggatatgtcagtcgcaagcgtgatgagaccatagcttat
atgaatgaaaggcacttcacagcaagtaccataaatgagggggcacaaagacatgaaaga
atagagaggaccaatcggttaatggaaggtcttccagctccaagcgatgcaaagaataaa
agccgaagaacaccaaagaaagaccctttctctataattcctccatcatatctacatctt
gctaattag

DBGET integrated database retrieval system