KEGG   Xenopus tropicalis (western clawed frog): 100488052Help
Entry
100488052         CDS       T01011                                 

Gene name
hspa1a, hsp70-1, hsp70-1a, hsp70i, hsp72, hspa1, hspa1b
Definition
(RefSeq) heat shock protein family A (Hsp70) member 1A
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr03040  Spliceosome
xtr04010  MAPK signaling pathway
xtr04141  Protein processing in endoplasmic reticulum
xtr04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100488052 (hspa1a)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100488052 (hspa1a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100488052 (hspa1a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100488052 (hspa1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xtr01009]
    100488052 (hspa1a)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:xtr03041]
    100488052 (hspa1a)
   03009 Ribosome biogenesis [BR:xtr03009]
    100488052 (hspa1a)
   03110 Chaperones and folding catalysts [BR:xtr03110]
    100488052 (hspa1a)
   04131 Membrane trafficking [BR:xtr04131]
    100488052 (hspa1a)
   03051 Proteasome [BR:xtr03051]
    100488052 (hspa1a)
   03029 Mitochondrial biogenesis [BR:xtr03029]
    100488052 (hspa1a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xtr04147]
    100488052 (hspa1a)
Protein phosphatases and associated proteins [BR:xtr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100488052 (hspa1a)
Spliceosome [BR:xtr03041]
 Complex B
  Other components
   Prp19 complex
    100488052 (hspa1a)
 Complex C
   Prp19-CDC5 complex
    100488052 (hspa1a)
Ribosome biogenesis [BR:xtr03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100488052 (hspa1a)
Chaperones and folding catalysts [BR:xtr03110]
 Heat shock proteins
  HSP70 / DNAK
   100488052 (hspa1a)
Membrane trafficking [BR:xtr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100488052 (hspa1a)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100488052 (hspa1a)
Proteasome [BR:xtr03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100488052 (hspa1a)
Mitochondrial biogenesis [BR:xtr03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100488052 (hspa1a)
Exosome [BR:xtr04147]
 Exosomal proteins
  Proteins found in most exosomes
   100488052 (hspa1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C CRIC_ras_sig Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 100488052
NCBI-ProteinID: XP_012823021
Xenbase: XB-GENE-5842877
UniProt: F6TJ80
Position
7
AA seq 648 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDPVVQSDMKHWPFTVINDGGRPKVQVEYKGEAKTFYAEEVS
SMVLTKMKEISEAYLGKTITNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA
IAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FVGEFKRKHKKDITENKRAIRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSLTRA
RFEELNADLFRGTLEPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGRELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGIMNVSAVDKSTGKENKITITNDKGRLSKEEIERMVQEADRYKAEDEVQREKISAKN
SLESLAFNMKSTVEDEKLKDKISPEDKQKILDKCNEVISWLDRNQMAEKEEYEHQQKELQ
NLCNPIITKLYQGAGGAGMPGGMPGGFPGAGAGAGGGGSSGPTIEEVD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaggtccagcagttggtattgacctgggcaccacctactcctgtgtgggtgtc
ttccagcacgggaaggtagagatcattgccaatgaccaaggaaatcggaccacgcccagc
tacgttgcatttacggatactgaaagacttattggtgatgctgccaagaatcaggtggca
atgaatccaaccaacacagtatttgatgctaagcgattgattggccgtcgctttgatgac
ccagttgttcaatcagacatgaagcactggccctttactgttattaacgatggagggcgt
cccaaggttcaagttgagtacaaaggagaggcgaagacattctatgcagaagaagtatcg
tctatggttctcaccaaaatgaaggagatttcagaagcctatctggggaagaccatcacc
aacgctgtgattacagttcccgcatacttcaatgattcccaaagacaggccactaaagac
gcagggacgatctctggcctcaatgttctgcgcatcatcaacgagccaactgcggccgcc
atagcatatggcctggacaagaaggttggtggtgaaagaaatgtcctgatttttgacctt
ggaggaggcacctttgatgtctccattcttacaattgaggatggtatatttgaggtaaaa
tccacagctggggacacacacctgggtggtgaggactttgataaccgcatggtcaaccat
tttgtaggggagttcaaacgcaaacacaaaaaggacattactgagaacaagcgtgccatc
cgacgtctgcgcacagcctgcgaacgtgccaaacgcaccttgtcctccagtacccaggct
agtattgaaatagactccctctatgagggcattgacttctacacctctctaacccgggcc
cgctttgaagaactcaatgccgacctcttccgtgggacactggagcctgtggaaaaagcc
ctcagagatgccaagatggacaaggcacagatccatgacattgttcttgttggaggttcc
acgcgcattcccaagatccaaaagctacttcaggacttcttcaatgggagagagctgaac
aagagcattaacccagatgaggctgttgcctatggtgcagctgtccaagctgcaatcctt
tctggggataagtcagaaaatgttcaagacctgcttcttctggatgtcacgcctctgtct
ctgggaattgagactgccggtggagtcatgactgttctcatcaaacgcaacacaactatc
cccaccaagcagacccagacatttactacgtactccgacaaccagccaggggtcttgatt
caggtgtttgaaggtgaaagggcaatgactaaagacaacaacctgcttgggaaatttgag
ctaaccggtattcctccagctccccggggggttccccagattgaagtgacctttgacatt
gatgccaatggaattatgaacgtgtcagctgtggataagagcaccgggaaagagaataag
atcactatcaccaatgacaaaggccggctgagcaaggaagagatagagcgcatggtacaa
gaggctgacaggtacaaggctgaagatgaagtccagagagagaagatttcggccaaaaac
tctctggagtccttggcctttaacatgaagagcacagttgaggatgagaagctgaaggac
aagataagtccagaagacaaacagaaaatcctagacaaatgcaatgaggtcatctcttgg
ttggacaggaaccagatggcagagaaagaggaatacgagcatcagcagaaagaactgcag
aacctgtgcaaccctatcatcaccaaactataccagggtgctggtggggctggaatgcct
ggtgggatgcctggaggattccctggggctggggcaggtgctggaggtggtggttcctct
ggtcctaccattgaagaagttgattaa

DBGET integrated database retrieval system