KEGG   Xenopus tropicalis (western clawed frog): 100488105Help
Entry
100488105         CDS       T01011                                 

Gene name
dock8
Definition
(RefSeq) dedicator of cytokinesis 8
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xtr04131]
    100488105 (dock8)
Membrane trafficking [BR:xtr04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100488105 (dock8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 100488105
NCBI-ProteinID: XP_002935647
Xenbase: XB-GENE-987088
Position
1
AA seq 2089 aa AA seqDB search
MASLSSAERRAFALKLNRNSSAEIRKHLSLQYSGEFIPLRGLGTPTSSTLQLPPFYDVVD
PVDFESFLMTHINNQDPEFRQELGDFFEDELDTVYKAKECRTVQPSLPEQGVELDPHVRD
CISTYIRESLIVTRKSQENQVIGSFSRSGSRKDFPKTLQKQVFESDEAEPRPNEQNDDSP
ITLLIDESGQTALTSCDFDLRGLRPETRLKNLLQFSNVEDLERQNEEARKSNRQSDLFAL
SPPMDEEDTVEIRPVPDCPKEHMGYRIMVKLHTLKFEIDIEPLFASFALYDLKEKKKISE
NFHCDLNSEVYKGYLRNHIPNIATSSQAKSAVFSITYPSQDIFLVVKIEKVLQQGEISDC
AEPYMVLKETESGKTKDKIEKLKSQAENFCQRLGKYRMPFAWAPVSLLNCINVMTLERDS
PESENPNGRNPATDRRASWTAGRRFSDRCNSLEENTQLPFKPTTLTVNSFFKQEGDKLSD
EDLFKHLADYKRSSLQRRIKSIPGLLKLEISPVCDGLSSCLSPELLPVKPEGRTRPIKEI
LEFPVKEVYVPHTIYRNILYVYPQRLNFANRLSSARNIAIKIQFMNGEDAKNAMPVIFGK
SSGPEFLSEVTTAVTYHNKTPDFYEEVKIKLPAKLTNRHHLLFTFYHISCQSKQGACVET
LLGYSWLPMLLNDRLQIGQYCLPVAMEKLPLNYSMHTPEKVPGQSPPIKWVEGHKGVFDL
EVQAVSSVHTQDNHLEKFLTLCHALEGPVTFPIRVLDQKITESSLEHELKLSVVCLSSSR
LEPLVLFLHLVLDKLFHLTVQPMVIGSQTANFSQYAFESVVSIVNSLHNSKDLSKDQHGR
NCLLASYVYYVFRLPEVQRDTIIAAGNLPEMRYYTVGRTSAASVGSKLMQSRSLSSSNPD
ITGNQNNADEEVKNIMSSKVTGRNFNRMSHFIEDSNDMQHVIACTRTSIIKHFHEEMALQ
MVVSTGMVRESVFKYAWFFFELLVKSMALYVHSVDKQDVPRRSRFSDRFKDDISTIVNVV
TSEIGSLLSKPQKESEQAEKINISLAFFLYDLLSLMDRGFVFNLIKHYCNQLTSKLNSFP
TLISMRLEFLRILCSHEHYLNLNLFFVTSSTPASPCPSISSENSSSCSSFQDQKIASMFD
LSPDYRQKHFLTGLLFTELDAALDSEMEGIGKVQRKAIGAIYNLLSSHDLDPRCQRIETK
QKIADLYLPLVSTILDALPQLHDFSAVDTRSGKARTSDEESETPSTINPSVAMAVAGNQF
NIKTSTISSVPVKVYSTLSPESSRILLTCFLWIMKNAEQNVIQKWITYMPILQLNRILDL
LYMCVSCFEYKGRQSSDKVSTLVLQKSRDVKARLEEALLRGEGARGEMMRRWKTGNERFA
GLNENLRWRKEQTQWRQANERLNMTKAEIEQEAIMCRNLATEANVTILDIVETIIQTSLS
IDCKDNLLGGVLKVLVHSLSTNQSNTFLTHCFSTIRLLIIKFADFLFEEEVEQCSDLCQK
VLHHCCSSLESTRSQACATLYLIMRFSFSNISNFARVKMQVTMSLASLVGKSQDFNEEFL
RKSLRTILAYAEEDEEMQPTLFPAQVDDLLNNLNSILSDTVKMRAFQEDPEMLMDLMYRI
AKGYQTSPDLRLTWLQNMAEKHVKRKCFTEAAMCLVHAAALVAEYLGMLEDCSYLPVGSV
SFQNISSNVIEESAVSDDILTPDDDGVCSGRYFSENGLIGLLEQAAELFNTAAFYETVNE
VYKIVIPVLEAHRDFHKLASTHKKLQKAFDNIAEKGQKRMFGTYFRVGFYGSKFGDLDEQ
EYIYKEPTITKLPEISHRLESFYGQCFGDDAVEVIKDSVPVDKSKLDPNKAYIQITFVEP
YFEDYEKKYRATHFEKNYNLRRFMYTTPFTLDGRPRGELSEQYKRKTILTTIHAFPYIKT
RINVIQKEEFELTPIEVAIEDMQKKTHELADATNKEPPDAKMLQMLLQGSVGATVNQGPL
EVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNKRLITADQREYQQELKKNY
NKLKENLRPMIERKIPELYKNVVKTRGDVRGLYHRTSFRKYDSQLSSSG
NT seq 6270 nt NT seq  +upstreamnt  +downstreamnt
atggcttctctctccagtgccgaaagaagagcctttgcgctgaagctcaacaggaattct
tcagcagaaataaggaaacatctctcccttcagtacagtggggaatttataccattgcgt
ggccttggtacaccaacctcttcaactctacaactacctccattttatgacgtggtagac
cctgttgattttgaaagcttcctcatgacacacatcaacaaccaagatcctgaatttcgg
caagaattgggtgacttttttgaagatgaattggatactgtatacaaagccaaggagtgc
aggactgtgcagccttctttaccagaacaaggagttgagctggatccacacgtccgagac
tgtatcagtacgtatatacgtgaatcgctgattgtcaccagaaaaagtcaagaaaaccaa
gtaataggaagctttagcagaagcggatctaggaaagattttcccaagactctccaaaaa
caagtgtttgagtcagatgaagcagaacctagaccaaacgaacagaatgatgatagtcca
atcactttgcttattgatgaatctggacaaactgcacttacatcctgtgactttgacctg
cgtggcttacgaccagaaactcggctgaagaacttgcttcaatttagtaatgttgaagat
ctggagagacaaaatgaagaagctcgcaaatccaataggcagtcagatctttttgctctc
agtccaccaatggatgaggaggacaccgtagaaatacgccctgtgccggactgtccaaaa
gaacacatgggatacagaataatggtcaaattgcatactttgaaatttgagattgacatt
gagccactgtttgccagctttgcactctatgacttaaaagaaaaaaaaaagatctctgaa
aattttcactgtgacctgaattccgaagtgtataagggttatctgcgcaatcacattcct
aacatagccacatcaagccaagcaaagtctgctgtgttttcaattacctatccctcccaa
gatatattcctagttgtcaagatcgaaaaagttcttcagcagggagaaatctcagactgc
gcagagccatatatggttttaaaagaaactgaaagtggaaagaccaaagataaaattgaa
aaactaaaatctcaagctgaaaacttttgtcagcgtctaggaaagtacagaatgccattt
gcatgggcacctgtgagcctcttaaactgcattaatgttatgacacttgaaagagattcc
cctgagagtgaaaaccccaatggaagaaatccggctactgacagaagagcctcatggact
gcaggaaggcgtttttctgatcgatgcaactcattggaagagaacacccaattgcccttc
aagcctacaacacttactgtcaacagtttctttaaacaggaaggagacaagctaagtgac
gaagatttatttaaacatctagcagactacaaaaggtcatctttgcaaaggagaattaaa
tctataccaggtctactcaaactggaaatttctcctgtctgtgatgggctcagctcttgt
ctttcacctgagttgctcccagttaaacctgaaggccgaacacgcccaattaaagaaata
ctagagtttccagttaaagaagtttatgttccacataccatttacaggaatattctgtat
gtctacccacaaaggctaaattttgcaaaccggctttcatctgcaagaaacattgctatc
aaaatccagttcatgaatggagaagatgctaaaaacgctatgcctgtcatatttgggaag
tccagtggcccagagtttttgtcagaagtcaccacagctgttacataccacaacaaaact
ccggatttttatgaagaagtgaaaattaaactgcctgctaaactcacaaatagacatcac
ttactatttacattttaccatatcagctgtcagtctaaacaaggagcatgtgtggaaact
ctgctgggatattcatggctgccaatgttgttaaacgatcgccttcaaataggacagtat
tgccttcctgtggcaatggaaaagctgcctctgaattattctatgcatactccagagaaa
gtgccagggcagtcaccccccataaaatgggtagaagggcacaaaggcgtttttgactta
gaggtccaggcagtctcatctgtgcatactcaggacaaccacctagagaagttcctcact
ctttgccatgctcttgaaggtccagtgacatttcccataagagtgctagaccagaaaatt
acagaatcatctctggaacatgaactaaagctcagcgttgtctgtttaagctcttccaga
ctagagcctctggtgctttttcttcatcttgtactggataaactttttcatcttactgtg
cagccaatggttattggaagtcagacagccaacttttctcagtatgcttttgaatcagtg
gtgtctatagtgaacagccttcacaatagtaaagacttaagcaaagatcagcatggcaga
aactgcttattggcctcttatgtatattatgtattccgtcttcccgaggttcagagagac
acgatcatagcagctggaaatctgccagagatgcgctactatacagtaggacgtacatct
gctgcatccgttgggtcaaaactaatgcagtcacgttcactgagctccagtaatcctgat
atcactggcaatcagaacaatgcagatgaagaagtcaaaaacattatgtcctctaaggtt
acaggtcgcaacttcaatcgtatgtcccattttattgaagacagtaatgatatgcagcat
gtcattgcgtgcacaaggacatctataataaagcactttcatgaagaaatggcccttcaa
atggttgtcagcactggaatggttagagaaagtgtcttcaagtatgcttggttcttcttt
gaactgctggtaaagagcatggccctatatgttcacagtgttgacaaacaggatgtcccc
aggagaagtcgcttctcagaccggtttaaagatgacataagcaccattgtaaatgttgtc
acttctgagattggatctctcttaagtaaacctcaaaaagagtcggaacaagctgagaaa
atcaacataagtctagcatttttcttatatgatttactatctctgatggacagaggtttt
gtttttaacctaatcaagcactactgtaatcagctgacctctaagctgaattctttccca
accttgatttctatgagactggagttcctgaggatcctttgtagccatgagcattatctc
aatctaaacctcttctttgtaacttcctccacgcctgcttctccatgcccttctatctct
tcagagaactccagctcctgctccagttttcaggatcagaaaattgcaagcatgtttgac
ctctcaccagattaccggcaaaagcattttctaactgggcttctgtttacagagttggat
gctgccctggactctgagatggaaggaattggcaaggttcaaaggaaagctataggtgca
atttacaacctgctgagttcacatgacctggacccacgctgccaaagaatagagacaaaa
caaaaaattgctgatctttacctgcctttggtcagtaccattttagatgcacttcctcaa
ctacatgatttttcagctgtagacacacgaagtggaaaagccagaacctcagatgaagag
tcagaaactccaagcacaattaacccaagtgtagcaatggctgttgctggaaaccaattc
aacataaaaacatctaccatatcttctgtgccagttaaagtgtactcaaccctaagccct
gaatccagcagaatcctgctaacatgcttcctttggatcatgaagaatgctgagcagaat
gtgattcagaagtggatcacctatatgcctattctgcagctaaacagaattctggatctg
ctctacatgtgcgtttcctgctttgaatacaaaggaaggcaatcttcagacaaagtcagc
accttggtgcttcagaaatcaagagatgttaaggcacgcctggaagaagcattgcttagg
ggtgaaggcgccaggggtgaaatgatgagacgctggaagacagggaatgaaagatttgct
ggactgaatgaaaatttacggtggagaaaagaacagacacagtggcgtcaagctaatgag
aggttaaatatgacaaaagctgaaattgaacaagaagccataatgtgtaggaacctggca
acagaagcaaatgtaactattttggatatagtggaaactatcatacagaccagtttgtcc
attgattgcaaagataatcttctgggaggagtccttaaagttcttgtacattccttgagt
acgaatcagagcaacaccttccttactcactgtttttcaaccatccgtctgctaattatt
aagtttgcagattttctgtttgaagaagaagtggagcaatgctcagatctgtgtcaaaag
gtcctacaccactgttgcagttccttggaaagcactcggagccaggcctgtgccactctg
tacctcatcatgagattcagctttagcaatatcagtaactttgccagagtgaagatgcag
gtaactatgtcactggcatccttggttggaaaatcacaagacttcaatgaagagttcctg
cgcaaatcattaaggacgattctggcctatgcagaagaggatgaggagatgcagcctaca
cttttcccagctcaggtggatgaccttttaaataacctgaacagcattctgtcagacaca
gttaagatgagggctttccaggaggacccagaaatgcttatggatttgatgtatagaatt
gccaagggctatcagacctccccagaccttaggctgacctggctgcagaatatggcagag
aaacatgtgaagaggaaatgctttactgaagcagccatgtgtttggttcatgctgctgcc
ctagtggcagaatatttaggcatgttagaggactgcagctatctgcccgtaggcagtgtt
agctttcagaatatttcctccaatgtaattgaggaatccgcagtttctgatgacattctc
actccagatgatgatggtgtgtgttctggaagatatttttcagaaaatgggttgatcgga
ctcttggagcaggctgctgaactttttaatacagcagcattctatgaaactgtaaatgaa
gtttacaaaattgtcatcccagttcttgaggcgcatcgtgatttccacaagctcgcatca
acccataaaaaacttcagaaagcttttgacaatattgctgaaaagggtcagaaaagaatg
tttggaacatacttccgtgtaggattctatgggtcaaagtttggagatttagatgagcaa
gagtatatttataaggaacctacgattacaaaacttcctgagatttcccatagattagag
agtttttatggtcagtgtttcggagatgatgctgtagaagttattaaagactctgttcct
gtggacaaatcgaaattggatcctaataaggcttacatacagattacctttgtggagccc
tattttgaagactatgaaaagaagtacagagccacccacttcgagaagaactacaacctt
cgtcgctttatgtatacaactccttttactctagatgggcgtcccagaggagaactcagc
gaacagtacaagagaaaaaccatcttaaccacaatacacgcatttccttacattaaaaca
cgcatcaatgtcatccagaaagaggagttcgaactcactcctatagaggttgccatagaa
gatatgcagaagaaaacacatgaattggctgatgcaaccaacaaggagccacctgatgcc
aagatgcttcaaatgttgcttcaaggctctgtaggagccactgtaaaccagggaccacta
gaggtagcccaagtgtttcttgctgaaattccagctgaccctaaactctatcgacatcac
aacaagctgagattgtgctttaaagagtttattatgcggtgtggtgaggcagtcgaaaag
aacaaaaggctcatcactgctgaccagagagaatatcagcaggaactgaagaagaactat
aacaaactgaaagagaacctgcgacccatgatcgagcgcaaaatcccagagctatataag
aatgtagtcaagacacgtggtgatgtccgagggctgtaccatagaacaagcttcagaaaa
tacgactcccagctctcttccagtggatga

DBGET integrated database retrieval system