KEGG   Xenopus tropicalis (western clawed frog): 100488289Help
Entry
100488289         CDS       T01011                                 

Gene name
cacng3
Definition
(RefSeq) calcium channel, voltage-dependent, gamma subunit 3
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
xtr04260  Cardiac muscle contraction
xtr04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100488289 (cacng3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100488289 (cacng3)
   04261 Adrenergic signaling in cardiomyocytes
    100488289 (cacng3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xtr04040]
    100488289 (cacng3)
Ion channels [BR:xtr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100488289 (cacng3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 100488289
NCBI-ProteinID: XP_002932480
Xenbase: XB-GENE-1010716
UniProt: F7BS52
Position
9
AA seq 317 aa AA seqDB search
MRMCERGVQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCKAKSTNDNETSKKNEEVMTH
SGLWRTCCLEGAFRGMCKKIDHFPEDADYEQDTAEYLLRAVRASSIFPILSVGLLFFGGL
CVAASEFYKNKHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQSDSKKSNYSYGWSF
YFGALSFIIAEMVGVLAVHMFIEKHRQIRAKSHSDLFKKSAFSRIPSYRYRFRRRSSSRS
TEPRSRDPSPVGKSFNPIPTSDISLYTLTSRDPTKVTVGSLLNSDREHNFLQVHNSLSKD
YKDSLHNNPSNRRTTPV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgtgtgaaagaggtgttcagatgttaatcaccaccgtgggggcctttgcagct
ttcagtctgatgaccatcgcagtgggcaccgactattggctctactcccggggggtctgc
aaggccaagtccaccaatgacaatgagaccagcaagaagaatgaagaggtcatgacccac
tcaggtctatggagaacctgttgccttgaaggagccttccgcgggatgtgcaagaaaatt
gatcatttcccggaggacgcagattatgaacaggacacggcggaatatttactgcgtgct
gtccgggcttccagtatcttccctatcctcagtgtgggcctcctgttcttcggtggtctc
tgtgttgctgccagcgagttctataagaacaagcacaatgttattctcagtgccggaatc
ttcttcgtttcagcaggcttgagcaacatcattgggatcatcgtttacatctcggccaat
gcaggagaccccgggcagagtgattccaagaagagcaactattcctatggctggtccttc
tatttcggtgccctgtcgttcatcatcgctgagatggtgggggtgttggccgtgcacatg
tttatagagaagcaccggcaaatccgagccaaatcccactctgacctgttcaagaaatct
gccttttcccgaatccccagttaccgatatcgattccgcaggcgttccagctcccgatcc
accgaacctagatccagggacccgtcccctgtgggcaaaagtttcaaccccattcccact
agtgacatttccctttacacattgacctcccgtgaccccaccaaggtgactgtgggttcc
ctgttaaattcagatagagaacacaacttcctgcaggtccacaactcactatccaaggat
tacaaagattctctccacaataacccttccaataggcgcaccacccctgtctga

DBGET integrated database retrieval system