KEGG   Xenopus tropicalis (western clawed frog): 100488480
Entry
100488480         CDS       T01011                                 

Gene name
slc38a10
Definition
(RefSeq) putative sodium-coupled neutral amino acid transporter 10 isoform X2
  KO
K14996  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 10
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    100488480 (slc38a10)
Transporters [BR:xtr02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   100488480 (slc38a10)
SSDB
Motif
Pfam: Aa_trans
Other DBs
NCBI-GeneID: 100488480
NCBI-ProteinID: XP_002940134
Xenbase: XB-GENE-958197
UniProt: F7A0K0 A0A6I8Q4H2
Position
10
AA seq 1058 aa
MAASNWGLIMNIVNSIVGVSVLTMPFCFKQCGIILGTLLLMLCAWMTHQSCMFLVKSASV
SKRRTYAGLAFNAYGKAGKMMVETSMIGLMLGTCIAFYVVIGDLGSSFFARLLGLQVTEG
FRVFLLFSVSLCIVLPLSLQRNMMASIQSFSAMALMFYTVFMFVIVLSSFKHGLFSGQWL
KHVSYVRWEGVFRCIPIYGMSFACQSQVLPTYDSLDEPSVKIMSSIFALSLNVVTTFYIT
VGFFGYVSFTESIAGNVLVNFPSNLVTEMIRVGFMMSVAVGFPMMILPCRQALNTLLFEQ
QQKDGTFTAGGYMPPLRFKVLTLVVVFGTMLGGILIPNVETILGLTGATMGSLICLICPA
LIYKKIHKKGLTSQFILGVGLVILVISTYATLTVTEEQKIKPEVLEREDLKEGKSDLEEI
QSQISDEKPIVEKPGDDRDKPKLPPKKLEEEQIKGPIEVPQKEDDTKKREEVQLDRPDQG
DIAVPVGEAHRHEPPVPRDEVAVDEKKDQEEREEKKESVVDNDDTEKKDKQEIKVENEQE
IKDQAEANNRIKEPVPQNPPQEVDDPNKQQLVNPPTPRVKEQPPFKDLEGIGKDVEVPVE
PKKNAEIAGEKNNNDFANPGKAVENPPIKDEKNEQVPGDPGKEQHEVQNGEPKAGDNQAE
AGKAELLDHAFLLQVIKEQQVQQKRLLDQQEKLLEVIKEQHMEIHQQKEDEEQQDKPEGN
IGENNKEELKAEAIVVQKPLDGDKVENAGQLKANIEKPAVEKPVVMEDKQQNSVLKEEVK
GNVPDVKKNEDKIEAPKIIVEEVKVAVSTGKESQDAKKQSIQENPNHHLDLEINDNHKQQ
EKVVVANKDNGLPNIGHIIQQENVNLKAPVALPDPQDKVGKLAQTELKQKPMKLAGAGEE
QLGAVREEKIQVQVQGVKAADLIPDNPKPAAEQGLHGNKKEADAPVLGLNQGNDIKVEVK
KEHAEKQKDGAVLEHDEGKQNRDLKLQDDLDLRRKKRDVNKEQENDAAQIISFHPVPNVK
VNDLRGALEARLNQLADGGIQVVQSRQIKQLIDEEKKR
NT seq 3177 nt   +upstreamnt  +downstreamnt
atggcagcgtccaactggggacttataatgaacatagtcaacagcattgtgggggtcagt
gtgctgacaatgccattctgtttcaaacagtgtggcataatcctgggcactctgcttctt
atgttgtgcgcctggatgacccaccagtcctgcatgttcctggtgaaatcggccagtgtc
agcaaacgtcggacatatgctggccttgcttttaacgcctatggaaaggctggaaaaatg
atggtggaaaccagtatgattgggctaatgctaggaacctgcattgctttctacgttgtg
attggtgaccttggctcctcgttcttcgctcgattacttgggcttcaggtgactgaagga
tttcgtgtgttccttctgttttcagtctccttatgtattgtcctccctctcagcttacag
cggaacatgatggcttccattcagtccttcagtgctatggctcttatgttctacacagtc
ttcatgtttgtgattgtgctgtcctcttttaaacatggactttttagtggccagtggttg
aagcatgtaagttatgtgcgctgggaaggtgttttccgctgcattccaatctacggcatg
tcgtttgcctgccagtcccaagttctgcccacgtacgacagcctggatgaaccatccgtt
aaaataatgagttccatctttgctttatccttgaacgtggtgaccacattctacataacg
gttggcttctttggttatgttagctttactgaaagcattgctgggaatgtgctggtaaac
ttcccctccaatctggtgacggagatgatcagagttggtttcatgatgtcggtagcagtt
ggtttcccaatgatgatcctgccttgtagacaagccttgaacacacttttattcgagcag
cagcaaaaggatgggacatttacagcaggaggatatatgccaccattacgatttaaagtc
cttacactggttgtggtgtttggtactatgctgggcggcatactcataccaaatgtggag
acaattctgggtctcacaggagcgactatgggaagtttgatttgcttaatatgcccagct
ctcatctataagaagatccacaagaaaggccttacttcacagtttatcctgggagtagga
cttgtgattctggtgatcagcacttatgctacattgactgtgaccgaggagcaaaaaatc
aaaccggaggtgctggagagagaggatctaaaggagggaaagtctgatcttgaggaaatt
caatctcagatttcagatgaaaagcccatagtggaaaaaccaggtgatgaccgggataaa
cccaaattgcctcccaagaagctagaagaagagcaaattaagggacctatagaggttcct
caaaaagaagatgacacaaagaagcgggaggaggtgcagctagatcggcctgatcaaggg
gacattgcagtacctgtgggtgaggcccatagacacgagccacctgtgccccgagatgag
gtagctgtagatgagaagaaagaccaggaagaaagagaagagaaaaaagaatcggtggtg
gacaatgacgatactgaaaagaaggataagcaagagataaaagtggaaaatgagcaagaa
ataaaggaccaggctgaggcaaacaatagaataaaagagcctgtgccacagaatccacca
caagaagtggatgacccaaataagcaacagctggtaaatcctcccaccccaagagtaaag
gagcagcctccattcaaggacctggaaggcattgggaaggatgtggaagttcctgtggaa
cccaagaaaaatgcagagattgcaggagagaaaaacaacaatgattttgctaatcctgga
aaggctgtagagaatccccccattaaagatgagaaaaatgagcaagttcctggtgaccct
gggaaagaacaacatgaggtgcaaaatggtgagccaaaagcaggagataaccaagctgaa
gctgggaaggcagagctgctggaccatgcatttttactacaagtcattaaggagcagcag
gtgcagcaaaagcgtttgttggatcagcaggagaaacttctagaagtaataaaagagcag
cacatggaaattcaccagcaaaaggaggacgaagagcagcaagataaacctgaaggcaat
ataggagagaacaataaggaggagctgaaagcagaagccatagtggtacaaaagccacta
gatggggacaaggtggagaatgcaggacaactgaaagccaatatagagaaacctgcagtt
gagaagcctgtggttatggaggacaaacaacaaaattccgttttaaaggaagaagttaag
ggaaatgtgccagatgtcaaaaagaatgaagataagattgaagctcccaaaatcatagta
gaggaagtgaaagtggcagtttcaactggcaaagagtcacaggatgcaaaaaaacagtcc
atccaggaaaaccctaatcaccaccttgacttggaaattaatgataaccataagcagcag
gagaaagtagtggtggcgaataaagataatggcctcccaaatattgggcacatcatccag
caggaaaatgtaaacctcaaagctcctgttgcactaccagacccacaggacaaggtggga
aaattagctcagactgagctaaaacagaaacctatgaaattggctggtgcaggagaggaa
cagcttggtgctgtgcgagaagaaaaaatacaggttcaagtccagggtgtgaaagctgct
gatttgataccggataatcccaagccagcggcagagcaagggctgcatggaaataaaaag
gaagctgatgcacctgtattaggcctaaaccaaggcaatgacattaaggttgaagtcaag
aaagaacacgctgaaaagcaaaaagatggggctgtcctagagcatgatgaaggtaaacaa
aaccgagatctgaaactgcaggatgatctggatttaagaagaaaaaagagagatgtgaat
aaggagcaagaaaatgatgcagcacagatcatcagtttccatcctgtgcccaacgtaaag
gtgaacgatctgcgtggcgcccttgaggcacggctcaatcagttggctgacggagggata
caggttgttcagagccggcaaatcaaacagttaatagatgaggagaagaagagatga

DBGET integrated database retrieval system