KEGG   Xenopus tropicalis (western clawed frog): 100490108
Entry
100490108         CDS       T01011                                 

Symbol
cxcl9
Name
(RefSeq) C-X-C motif chemokine 11-1
  KO
K12671  C-X-C motif chemokine 10
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04060  Cytokine-cytokine receptor interaction
xtr04620  Toll-like receptor signaling pathway
xtr04622  RIG-I-like receptor signaling pathway
xtr04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100490108 (cxcl9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100490108 (cxcl9)
   04622 RIG-I-like receptor signaling pathway
    100490108 (cxcl9)
   04623 Cytosolic DNA-sensing pathway
    100490108 (cxcl9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xtr04052]
    100490108 (cxcl9)
   00536 Glycosaminoglycan binding proteins [BR:xtr00536]
    100490108 (cxcl9)
Cytokines and growth factors [BR:xtr04052]
 Cytokines
  Chemokines
   100490108 (cxcl9)
Glycosaminoglycan binding proteins [BR:xtr00536]
 Heparan sulfate / Heparin
  Chemokines
   100490108 (cxcl9)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100490108
NCBI-ProteinID: XP_002940620
UniProt: A0A7D9NM09 F7DAH3
Position
1:complement(81384478..81387545)
AA seq 96 aa
MAVGKALALFCGLLLILSCVCGMSPLGKQRCMCKGRGAERISTQHLKKLEVFPMSFGCDE
IEVIVTMKSGSKICLNPQSKFANKLLSALRKKRSSK
NT seq 291 nt   +upstreamnt  +downstreamnt
atggctgtgggtaaagcacttgccctcttctgcggtctgctcctcatcctgtcctgtgtt
tgtggaatgtccccacttgggaaacaacgctgcatgtgcaaagggcgcggtgccgaaagg
atcagtacccagcatctgaaaaaactggaggtgtttccaatgagttttggctgtgatgag
attgaggtcattgtaacaatgaaatcaggaagtaagatctgcctcaatcctcaatcaaaa
tttgccaacaaactcctttctgcactgcggaaaaagagatcttcaaagtga

DBGET integrated database retrieval system