KEGG   Xenopus tropicalis (western clawed frog): 100491159
Entry
100491159         CDS       T01011                                 

Symbol
krt78.1
Name
(RefSeq) keratin, type II cytoskeletal
  KO
K07605  type II keratin, basic
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:xtr04812]
    100491159 (krt78.1)
   04147 Exosome [BR:xtr04147]
    100491159 (krt78.1)
Cytoskeleton proteins [BR:xtr04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     100491159 (krt78.1)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   100491159 (krt78.1)
  Exosomal proteins of other body fluids (saliva and urine)
   100491159 (krt78.1)
  Exosomal proteins of colorectal cancer cells
   100491159 (krt78.1)
  Exosomal proteins of bladder cancer cells
   100491159 (krt78.1)
SSDB
Motif
Pfam: Filament Keratin_2_head
Other DBs
NCBI-GeneID: 100491159
NCBI-ProteinID: XP_002935786
Xenbase: XB-GENE-6035591
UniProt: A0A6I8S2K8
Position
2
AA seq 493 aa
MSWSLHQRVTTSTGSGKGFSGLSLGGGSRMGINSASASSRLSNSSARFGSRSLILSGSRK
VSSVASSGRFGAGYGAISAAGAGGFGGPGSFSGIQQVNINQSLLAPLNLEIDPSISVVRK
EEREKIKLLNNKFASFIDKVRFLEQQNKVLETKWSLLQKQQVSKSRSSEIESIFNTLITS
LRSQLDSLVKDKGLLGGELQVMKDHAENFKNKFELEFKKRTADENDFVSLKKDVDATYLI
QVQLETKQKALDDELAFLRNLYKEELDGIKQQTAGTSVVLSMDNSRMLDLGDIIADVKAQ
YEDTTRRSKEEAEAAYQSKYQQLQLAAGQQGEDLKSSKKEISEVNRSVQKLRNEIESVKK
QIASLQVSIQDSERRGDIALRDAQEKLVNLERALQKAKQEMAQQLREYQTLLNVKLALDV
EIATYRKLLEGEESRITGQVSDAVTVSFVSGAKSSFDATKRSAGIDTGVKRRGSSGVKII
SKTESSSLVSLYQ
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgagctggagtttgcaccaacgtgtgaccacttccacaggttctgggaaaggattcagt
ggcctttccttaggaggtggtagcagaatggggataaactcggcttctgccagcagtcga
ctttccaatagctctgccagatttggaagtaggagtctcatcttgagtggcagcagaaag
gtatcctctgtagcaagcagtggcaggtttggagctggatatggtgccatatctgctgct
ggggctggaggatttggtggccctgggtccttctcaggtatccaacaagtaaatatcaat
caaagccttctggctccactcaatttggaaattgacccaagcatttcagtcgttaggaaa
gaagagagagagaagataaagcttctgaataataaatttgcatctttcattgataaggtc
cgattccttgaacagcagaataaagttcttgagactaaatggagcctcttacagaaacag
caagtttcaaaatctaggagctctgagattgaatccatctttaatactcttattaccagt
ctgagaagccaactggacagtttggtgaaagacaagggcctccttggtggagaactgcag
gttatgaaggatcatgctgagaactttaagaacaagtttgagttagaattcaaaaagaga
actgcagacgagaacgattttgtgtcacttaaaaaggatgtagatgccacttacctgatt
caagtgcagttggagaccaaacagaaagcattagatgatgaactcgcattcctgagaaat
ctctataaagaggaacttgatgggatcaaacagcaaacagctggtacctcagtagtcctc
tctatggacaacagtcgtatgttggacctaggagacattattgctgatgttaaggcgcag
tatgaggacactaccaggaggagcaaagaggaagcagaagctgcatatcagagcaagtac
cagcagttgcagctcgctgcaggccaacaaggagaagatctgaaaagcagcaagaaagag
atatcagaagttaacagatccgttcagaaactaaggaatgaaatagagagtgtgaagaag
cagattgccagtttgcaggtttctattcaagactctgaaagacggggtgacattgctttg
agagatgcccaggaaaagctggttaaccttgaaagggctctgcagaaggccaagcaggaa
atggcccagcagctcagggaatatcaaacactattgaatgtgaaactggccctcgatgtt
gaaattgccacttatcgaaaacttctggaaggagaggaaagcaggataactggccaagtc
tccgatgcagttactgtctcttttgtaagtggcgccaagtcttcatttgatgcaaccaaa
agatctgcaggtattgacactggcgtgaaaagaagaggaagttccggagtgaaaataatc
tctaagacagaaagcagcagccttgtttcactctatcagtaa

DBGET integrated database retrieval system