KEGG   Xenopus tropicalis (western clawed frog): 100491719Help
Entry
100491719         CDS       T01011                                 

Gene name
map4k4, hgk, mekkk4, nik
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100491719 (map4k4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xtr01001]
    100491719 (map4k4)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100491719 (map4k4)
Protein kinases [BR:xtr01001]
 Serine/threonine kinases: STE group
  STE20 family
   100491719 (map4k4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr DUF2477
Motif
Other DBs
NCBI-GeneID: 100491719
NCBI-ProteinID: XP_002934552
Xenbase: XB-GENE-1011650
Position
2
AA seq 1403 aa AA seqDB search
MANDSPAKSLVDIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNSLKEDWIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPPTEQLLKHPFIRDQPNERQVRI
QLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGESTLRRDFLRLQ
QENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREAR
RQQEREQRRREQEEKKRMEEMERRRKEEEERRRAEEEKRRVEREQEYIRRQLEEEQRHLE
ILQQQLLQEQAMLLEYRWREMEEHRQAERLQRQLQQEQAYLMSLQHDHRQQQPPQQQPQP
QQPPLSQQERSKQTYHTQEPKPHYEQAERIREAEERLRKANQGSPEAQAKQPGRVLEPLV
PSRSESFSNGNSEPAQPAMHRPVEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAPHLL
RSQDSHQTSRSEVQSQGSDPKSEISEPTQRVWARSDSDEVPPRVPVRTTSRSPVLSRKDS
PLQGSGQQNTQAGQRNSTSNIEPRLLWERVEKLVPRPGSGSSSGSSNSGSQAGSHPGSQS
GSGERFRMRSSSKSEGSPSQRHENTAKKSEEKKEAVRQAKAPGEVDLTALAKELRAVDDV
RPLHKVTDYSSSSEESGTTDEEDDDMEQEGADESTSGPEDARAMSSLNLSNGETESVKTM
IVHDDVESEPAMTPSKEGTLIVRQSTVDKKRANQLESNGFASRIHLLPDLLQQSHSSSTT
SSPTSSQPTPTMSPQTPQDKLTANETQSASNTLQKHKSSSSFTPFIDPRLLQISPSSGTT
VTSVGTYMRTLEANLKNTNFILVGFSSEALRPDAMRQDPTRKGSVVNVNPTNTRPQSDTP
EIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGL
NVLVTISGKKNKLRVYYLSWLRNKILHNDPEVEKKQGWTTVGDLEGCVHYKVVKYERIKF
LVIALKSSVEVYAWAPKPYHKFMAFKSFGDLVHRPLLVDLTVEEGQRLKVIYGSCAGFHA
VDVDSGAVYDIYLPTHIQSSIQPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVL
QWGEMPTSVAYIRSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFA
SVRSGGSSQVYFMTLGRSSLLSW
NT seq 4212 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgattcgcctgccaaaagtcttgtggatatagacctgtcgtctctgagggac
ccagctggcatctttgaattagtggaagtggtaggaaatggcacctatggacaagtatat
aagggccgacatgtcaaaacaggccaacttgcagccatcaaagtcatggatgttacagag
gatgaagaggaagaaatcaaactggaaatcaatatgttgaagaaatattcccaccacaga
aatatagctacttattatggtgcttttattaagaaaagtcctcctgggcatgatgaccag
ctttggttggtgatggagttttgtggtgctggctcaatcactgacctggtgaagaataca
aaggggaatagtttgaaagaagactggattgcctatatctctcgtgagatacttagggga
ttggcccacctccatgctcatcatgtgattcaccgggatatcaaaggacagaatgtgctg
ctaacagagaatgccgaagtgaaattagtggattttggtgttagtgcacagctggatagg
acagtgggccgaaggaacacatttattggtacaccatactggatggctccagaagttatc
gcctgtgatgagaacccagatgctacctatgactataggagtgacctctggtcatgtggt
attacagcgattgaaatggcagaaggtgctcctcctctttgcgatatgcatccaatgcga
gccctgttccttatcccaagaaatcctccaccacggctaaaatccaagaaatggtcaaag
aagttcttcagctttatagaaggctgccttgtgaaaaattacatgcaacgtcccccaaca
gaacagcttttaaagcatccatttatacgagatcagccaaatgaaaggcaagtccgaatt
cagctgaaggatcacatagacaggacaaggaagaagagaggagaaaaagatgaaacagag
tatgaatacagtggaagtgaagaggaggaagaggaagtgcctgaacaggaaggagaacca
agttccattgttaatgtgcctggggaatcaacactccgacgtgatttcctgagactgcag
caggagaacaaggagcgctctgaggctttgcgacggcaacagctgctgcaggagcaacaa
ctcagagagcaggaggaatataaaagacagctcctggcagagagacagaagcgcatagaa
cagcagaaagagcaaaggaggagacttgaagagcaacaaagaagagagcgtgaggctcgt
cggcagcaggaacgagaacaaagaaggcgagagcaagaggaaaagaagagaatggaggag
atggaaagaaggcgcaaggaagaggaagaaaggagaagagcagaggaagagaaaagaaga
gtggaaagagagcaggagtatatccgaagacagctggaggaggagcagcggcacttagaa
atccttcagcagcagctgcttcaggagcaggccatgttactggagtatagatggcgtgaa
atggaggagcaccgccaggctgaaagacttcagcgtcagttgcagcaagagcaggcctat
ctcatgtcactacagcatgatcatagacagcagcagccaccacaacagcagccccagccc
cagcagcctccactgtcccagcaggaaaggagcaagcaaacataccatacccaagaaccc
aagcctcattatgaacaagcagaacgaatacgagaggcagaggagcgccttaggaaagca
aaccaaggctcccctgaagcccaggctaagcaaccaggaagagttttagagccattagtg
ccttcaagatccgaatcattttccaatggaaattctgagcctgctcaacctgccatgcac
agaccagtggaaccacaggtacagtggtctcatctggcatccctcaagaacaatgtatcc
cctgtctcgcgatcccattccttcagtgacccttctcccaaatttgcacctcaccttcta
cgatctcaggattcgcaccaaacttcacgcagtgaagtgcaaagtcagggttctgaccct
aagtctgaaatctctgagccaacccaaagggtttgggctcgatcagacagtgacgaggtg
cctccaagggtgcctgtgaggacaacatcaagatctccagtattgtcacggaaagattca
ccactgcagggcagtgggcagcaaaatacccaagctggtcagagaaattccacaagcaat
attgagcctagacttctttgggaaagagtagagaagcttgtgcccagaccgggtagtggt
agctcgtcaggatcaagtaactctggatcccaagcaggatcccacccaggatctcagagt
ggatctggagagcgcttccggatgagatcatcttcaaaatctgagggctcaccatctcaa
cgacatgaaaacacagccaaaaagtctgaagagaagaaagaagcagttagacaggccaaa
gctcctggagaagtggatcttactgcactcgctaaggagcttcgagcagtagatgatgtt
cggccacttcacaaagttactgactattcctcatccagtgaagagtctggtactacagat
gaggaggatgatgacatggaacaggaaggagcagatgaatcgacttcaggcccagaggat
gctagagctatgtcatctttgaatttaagcaatggagaaacggagtctgtgaaaaccatg
atcgtacatgatgatgtcgaaagtgaacctgccatgaccccatctaaagaaggcacttta
attgtccgacagagtacagttgacaaaaagcgtgccaaccaacttgagagcaatggcttt
gcgagtcgtattcacctcttgccagatctcttacagcaaagccattcctcctccaccact
tcttccccaacctcaagtcaaccgacacctaccatgtccccccagacaccccaggacaag
ctaactgctaatgagactcagtcagctagtaatactctccagaaacacaaatcgtcctcc
tctttcacaccgttcatagatccaaggttacttcagatctctccatctagtggaacaact
gttacgtcagtaggtacatacatgcgcacactggaagctaaccttaaaaatactaatttt
attttagtgggattttccagtgaagcgctaaggccggatgccatgaggcaagatcctaca
aggaaaggatcagttgttaatgttaatcccacaaatactcggccacaaagtgatacacca
gagattcgcaaatacaagaagagatttaattctgagattttgtgtgcggcattgtggggt
gtaaatttgctggtgggaactgaaagtggtttaatgctgttggatagaagtggacaaggg
aaagtgtaccccctcattaacagaaggcgatttcagcagatggatgtgcttgaaggcttg
aatgtcttggtaactatatcagggaaaaagaacaagctgagagtatattacttatcctgg
ctgaggaataaaattttgcacaatgatcctgaagtagagaagaaacaaggatggacaaca
gttggggatttggaaggctgtgtgcactacaaagttgtaaaatatgaacgtatcaagttt
ttggtaatcgctttaaaaagttcagtggaggtgtatgcctgggcaccgaaaccataccac
aagtttatggcctttaagtcattcggagatttagtacacagacctctccttgtagacctg
actgtggaagaaggacagaggctgaaagtgatctatggttcctgtgctgggtttcatgca
gtagatgtggactcgggcgcagtttatgatatttacttgccaacacatattcagagcagc
attcagccacacgcaatcatcattctcccaaatactgatggtatggaactgctggtttgc
tatgaagatgaaggagtttatgttaatacatacggcaggatcaccaaagatgtagttcta
caatggggagaaatgcctacatcagttgcttatatccgatctaaccagatcatgggatgg
ggtgaaaaagctattgagattcgatccgtggaaactggccaccttgatggagtatttatg
cacaaaagggcacaaaggctcaagttcttgtgcgaacgaaatgacaaggttttctttgcc
tcggtgcggtctggcggaagcagccaagtgtatttcatgactttgggcagaagctctctt
ctgagctggtag

DBGET integrated database retrieval system