KEGG   Xenopus tropicalis (western clawed frog): 100492367Help
Entry
100492367         CDS       T01011                                 

Gene name
h3c13
Definition
(RefSeq) histone H3
  KO
K11253  histone H3
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xtr03036]
    100492367 (h3c13)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xtr04147]
    100492367 (h3c13)
Chromosome and associated proteins [BR:xtr03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    100492367 (h3c13)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100492367 (h3c13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 100492367
NCBI-ProteinID: XP_017952908
Xenbase: XB-GENE-5889771
UniProt: Q28D37 A0A1B8XZW2
Position
9
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtaccaagcagaccgcccgtaaatccaccggagggaaagctccccggaagcag
ttggctaccaaggcagccaggaaaagtgctccagccaccggcggcgtaaagaagcctcac
agataccggcccggcacagtcgctctccgggagatccgccgctaccagaaatccaccgag
ctgctcatccgcaagctgcctttccagcgcctggtccgggagatcgctcaggacttcaag
accgacctgcgcttccagagctcagccgtcatggctctgcaggaggccagcgaggcttat
ctggtcggtctctttgaggacaccaacctgtgcgccatccacgcaaagagggtcaccatc
atgcccaaggacatccagctggcccgcaggatccgaggcgagagggcttag

DBGET integrated database retrieval system