KEGG   Xenopus tropicalis (western clawed frog): 100492776Help
Entry
100492776         CDS       T01011                                 

Gene name
adra1a
Definition
(RefSeq) adrenoceptor alpha 1A
  KO
K04135  adrenergic receptor alpha-1A
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04020  Calcium signaling pathway
xtr04080  Neuroactive ligand-receptor interaction
xtr04261  Adrenergic signaling in cardiomyocytes
xtr04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100492776 (adra1a)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100492776 (adra1a)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100492776 (adra1a)
   04270 Vascular smooth muscle contraction
    100492776 (adra1a)
G protein-coupled receptors [BR:xtr04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    100492776 (adra1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 100492776
NCBI-ProteinID: XP_002933012
Xenbase: XB-GENE-6048410
Position
3
AA seq 489 aa AA seqDB search
MIKSWRDNIYARSSAISFTMVILYENNTVESIQLCLNCTHPGATINISKAIVVGVIFGVF
ITFGVLGNILVILSVACHRHLQTVTHYFIANLAVADLLLMSMVLPFSATFEIQGYWLFGR
IFCNIWAAVDVLCCTASIMSLCAISIDRYIGVSYPLRYPSIMTEKRGVLALLCIWVLSLV
ISIGPLFGWKQPAPEDDKICEITKEPGYALFSAFGSFYLPLSIILVMYFRVYIVAKRESK
VLTSGMKLEKSDSEEVTLRIHRKSTPESIGSTSSSKQKTQFSVRLLKFSREKKAAKTLGI
VVGCFVLCWLPFFLVMPIGSIYPPANSSDTIFKITFWLGYFNSCINPVIYPCSSPEFRKA
FQNILHARCSHRRQAASKYSSGFLLNSPVHRSSEENKNVVRIPVGSGEMFYRISKSDEGC
EWKYFTPLPSPATPYGTPRDFANCSSARVSSKSFLRTCCCVGTQQTRSCHDVPTIKIHTI
SVSENGEAV
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgattaagagctggagagacaacatctatgcaagatcttctgccatctccttcactatg
gtaattctctatgaaaataacacagtagaaagcatccagctctgcttgaactgcacccat
ccgggggcaacaatcaacatttccaaggccattgtggttggtgttatttttggggtgttc
atcacttttggagttcttggaaatatcttggttattctttcagtggcctgtcatcggcat
cttcagactgtgactcactattttattgccaaccttgccgttgctgacctgctcttaatg
tccatggtgcttccattttctgcaaccttcgagatacaaggttactggttgtttggtcgc
atcttttgcaacatctgggctgctgtggatgtcctctgttgtacagcctccataatgagt
ctgtgtgccatatccattgacagatacataggagttagctacccacttagataccccagc
atcatgactgaaaaaagaggtgttctagctttgctttgtatatgggttttgtcccttgtg
atctcgattggacctctatttggttggaagcagccagctccagaagatgataaaatctgt
gaaatcactaaagaaccagggtatgcacttttctcagcctttggatcattctacctgcct
ctcagtatcatccttgttatgtactttagggtatatattgtggccaaaagggaaagcaaa
gtgttaaccagtggaatgaagcttgagaagtctgattctgaggaggtaaccttaaggatt
catcggaaaagcaccccagaaagcatcggttccacttctagttcaaagcaaaagactcaa
ttctcagtgcgccttctcaagttttccagagaaaagaaagctgctaagactttgggtatt
gtagtaggatgcttcgtgctgtgctggcttccattttttcttgtcatgcctataggatcc
atttatcctccggccaactcgtcggatactattttcaagattacgttttggctgggttat
tttaacagctgcatcaacccagtgatctatccttgttccagccccgagttccggaaggcc
ttccaaaacatactccatgctcggtgctcgcacaggaggcaggctgccagcaagtactcc
tctggtttcctcctaaacagcccagtgcaccggagttcagaggaaaacaaaaatgtggtg
agaattcccgtgggctcgggggagatgttttacaggatctccaagtctgatgagggttgt
gaatggaaatattttacccccctgcccagcccggccacgccatacggcactccaagagat
tttgccaactgttcctctgccagagtgagcagtaagtcttttctgagaacctgctgttgt
gttggcacccaacagactcgctcttgccatgacgtgcccaccatcaagatacataccatc
tctgtgagcgagaacggtgaagccgtttga

DBGET integrated database retrieval system