KEGG   Xenopus tropicalis (western clawed frog): 100492918Help
Entry
100492918         CDS       T01011                                 

Gene name
khk
Definition
(RefSeq) ketohexokinase
  KO
K00846  ketohexokinase [EC:2.7.1.3]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00051  Fructose and mannose metabolism
xtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    100492918 (khk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xtr04147]
    100492918 (khk)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.3  ketohexokinase
     100492918 (khk)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100492918 (khk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 100492918
NCBI-ProteinID: XP_002943517
Xenbase: XB-GENE-997647
Position
Un
AA seq 213 aa AA seqDB search
PPSYPSLLLDCACCLVNVSSGSRTVTLYDTNLPDVTEEDFRSVDLTRYKWIHWEGRNAAE
QVKMIRRVEEHNSGRGAEERITVSVEIEKEREELYQLFPHGDVVFVSKDVARHFGFHSAQ
EAVRGLYPRVRKGAYLVCAWAEEGADALGPDGSVVHSCAFPPDCIVDTLGAGDTFNASVI
YALSHGRGMQEALTYGCQMAGKKCGVQGFDGII
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
ccaccttcctacccgtctctcctcctggattgcgcttgctgcctggtgaatgtgtcgagt
ggctctcggacggtgacgctgtacgacacgaacctgcccgacgtgaccgaagaagacttc
aggagcgtggatctgacgcggtacaagtggatacactgggagggcagaaacgcagctgag
caggtaaagatgatccgcagggtggaggagcacaacagcggccgcggcgcagaggaacgc
atcactgtctccgtggagattgagaaggaaagggaggagctgtaccaactcttcccacat
ggggacgtggtgtttgtgagtaaggacgtggcgcggcactttggctttcactctgcgcag
gaggccgtgcgtggcctgtacccccgggtgaggaaaggggcctacctggtgtgcgcgtgg
gcagaggagggagcagacgcattgggccccgatggttccgtcgttcattcctgcgctttc
ccccctgactgcatcgtcgacacgttgggggccggggacacgttcaacgcctcggtgatc
tacgcgctgtcccacggtcggggcatgcaggaggcgctcacgtacgggtgccaaatggcc
ggcaagaaatgcggggtgcaggggtttgatggcatcatctga

DBGET integrated database retrieval system