KEGG   Xenopus tropicalis (western clawed frog): 100493499
Entry
100493499         CDS       T01011                                 

Gene name
aff3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:xtr03021]
    100493499 (aff3)
Transcription machinery [BR:xtr03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     100493499 (aff3)
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int
Other DBs
NCBI-GeneID: 100493499
NCBI-ProteinID: XP_031752871
Xenbase: XB-GENE-1005828
Position
2
AA seq 963 aa
MTWQDPGHSFAHQQQLKTSDRKMVGSATKDCIGGHQKCVMEKNKNCLLQPVLSPSSSDNP
PQNILVSNKNSSHRRQHPQLNCSLEISSSAPCMQNFSATKLNAVQQKPTAYVRPMDGQEQ
AVDESPKLKSSTEVNILLPLYRELCHKRVSDKIKSDEIDTCSNLNQEEENHLSNIGLSSK
KNADFKDRSPTKCAPQISMLEDDLKLSSDEEDIDQQAVQEESLGVQSDSGEVQDLSKRTS
GVSTLTSSSSSESDTSSESDSESESSSSEAECTKASGYISPEPEQPTSNKWQLDKWLNKV
HPNKTVILSNTHCPSYGSLKEDAGNSENLSQICQSNHNCNKDTREDKRPWNICTDLGNNK
DTGLKSSASIEIAASIAVAVPTTESTFQRQPACRKLTRRTEQTSTGDKQNCYSPDEPSLN
QATVGDNITEQPKSRLLGTGRGLYKRDPRTSKLGAEIRRTRGLNRSASKSKEFIQFSSQS
SDLGIETELEISALSTNTSATPATENNHRLKEWGGNNINRASPCVANTTTTTDLAKELDE
QYYTLVPFGRNENVFSIKGNDEVKSLWVRIDLTLLSRIPVELAQETLIMNTSMKEAHRSS
THKSFTSVAEKALEKTRKKRKSENEASREVKKNHVEKDNCLQETVLSDTFDMANLHSTNP
IRTSMSESKSHVYQRSLHVPSETSTLLHTEDVHLNLWSSLPHGHKDLRSQMLFDNRPRSA
DYFMQEAKQMKHKADAMMDKFDKVLNYTEAALSFIECGNAMEHGPIESKSPYTMYAETVE
LIRYALRLKSHSGPNATSQDKKITALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKSS
SKASQASSSQGSNGKTTGTPSPTSPSPSSVSSVGSQGSTSNSSIISIPQRIHQMAANHVS
ITNSILHSYDYWEIADNLTKDNQEFFNELDVLMGPITLHSSMEHLVQYTRQGLHWVRHSA
HML
NT seq 2892 nt   +upstreamnt  +downstreamnt
atgacctggcaggatcctggccattcatttgcgcatcagcaacagttaaaaacatctgat
cggaaaatggttggttctgctacaaaagactgtataggtgggcaccagaaatgtgttatg
gaaaaaaataaaaactgcttgttacaacctgtattatcaccatcctcatctgataaccct
ccacaaaatattttagtgagtaataagaacagttcccacaggagacaacatccacagcta
aattgcagcctagaaatcagcagcagtgcaccctgtatgcagaacttttctgccacaaag
ctgaatgcagttcagcaaaagcctactgcatatgtgcgtccaatggatggtcaagaacag
gcagtagatgagtcgccgaagctaaaatcttccaccgaagtgaatattctcctccctttg
tatagagaactttgccataaacgtgtctctgacaagataaagtctgatgaaatagataca
tgctccaatctcaaccaagaagaggagaatcatctgagcaacataggactatccagtaaa
aagaatgctgatttcaaggacaggagcccgacaaagtgtgcacctcagatatcgatgttg
gaagatgacttgaagctaagcagcgatgaggaggatattgatcagcaggcagttcaggaa
gaatccttaggagtccaaagtgacagtggggaagttcaggatctcagtaaaagaacttca
ggagtttccacactgacaagcagcagctccagtgaatctgacactagttcagagtcggac
tctgaaagcgaaagcagttccagcgaggcagagtgcactaaggcttcaggctacataagc
cctgagcctgagcaaccaacatcaaacaaatggcaattggataagtggctcaacaaagtt
catcctaacaaaaccgtgattctcagcaatacacattgcccttcttatggtagtttaaag
gaggatgctggcaacagtgaaaatttgtcacaaatatgccagtctaaccataactgtaat
aaagatacaagggaggacaaaagaccatggaacatatgcacagacctagggaataataaa
gacacaggattaaaatcttcagcttccattgaaattgctgcttcgatagctgttgcagtt
cctacaacagaaagcacttttcagagacaacctgcttgcagaaaactcacaaggaggaca
gaacagacatctactggagataaacagaactgctatagtccagatgagccttccttaaac
caagcaactgttggtgataatataacagaacagcctaaaagcagattgttgggaacaggt
agaggtttgtacaaaagagatcccaggacatctaaactaggggctgaaattaggaggact
cgaggtttaaacagatcagcttccaaatccaaggaatttattcagttttcatctcagtct
tcagatcttggaatcgaaacagaactggaaatctcagctctttccacaaatacatcagcc
actccagcaactgaaaataaccacagacttaaggagtgggggggcaataatattaatagg
gccagtccatgcgttgccaataccactaccacaactgacttagctaaggagctggatgaa
cagtattacacactggttccatttggtaggaatgagaatgtcttttcaataaagggcaat
gatgaggtcaagtcactttgggtcaggattgatttaactcttttatcaagaataccagtg
gaactggcccaggagactcttatcatgaataccagtatgaaagaagcacacaggtcctca
actcataaaagttttacttcagtagcagagaaggctttggagaaaaccaggaagaaacgt
aagtctgaaaatgaagcgtctcgggaagtgaaaaaaaatcatgtagaaaaggacaactgt
ttgcaagaaactgttttatctgacacctttgatatggccaatttacacagcaccaacccc
atcaggaccagcatgagtgaaagcaaatctcatgtttatcagagatccctccatgttcct
tcagaaaccagcactttgcttcatacagaagatgtgcacttaaacctttggtcatctttg
ccacatgggcacaaagatttaagaagtcagatgttgtttgacaataggccgcgcagtgca
gactattttatgcaagaagctaaacagatgaagcataaagcagatgcaatgatggacaaa
tttgacaaagttctgaattacactgaagcagccttatcgttcattgagtgtgggaatgca
atggaacatggccccattgagtcaaagtctccatatacaatgtatgctgaaacagtagaa
ctaataaggtatgccttgaggttaaaatcacactcgggtcctaatgcaacttcccaggac
aagaaaatcacagcattatgctatcgctgtttggctcttctgtactggagaatgtttagg
ctcaaaagggatcatgctgtaaagtactcaaaagctcttattgactatttcaagagctca
tctaaagcatcccaagcttcatcctcacagggttccaatggaaaaaccactggtactcca
tcccccacatcacctagtccttcttcggtgagttctgttggttctcaaggaagtacctcc
aacagctctattattagcatcccacagcgaattcaccagatggcagcaaaccatgtcagt
attaccaacagcattctgcacagctatgactactgggagattgctgataatctcaccaaa
gacaaccaagagttctttaatgagcttgatgtgttaatgggaccgatcacgctgcacagt
tcaatggagcacttagtacagtacacacgtcaaggacttcattgggtacggcacagtgca
cacatgctttag

DBGET integrated database retrieval system