KEGG   Xenopus tropicalis (western clawed frog): 100493648Help
Entry
100493648         CDS       T01011                                 

Gene name
minpp1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00010  Glycolysis / Gluconeogenesis
xtr00562  Inositol phosphate metabolism
xtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100493648 (minpp1)
   00562 Inositol phosphate metabolism
    100493648 (minpp1)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100493648 (minpp1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100493648 (minpp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 100493648
NCBI-ProteinID: XP_002935472
Xenbase: XB-GENE-952972
Position
7
AA seq 483 aa AA seqDB search
MSFLFAACRPHTPKPFQILLFSITWICSSTRTSVGSQPPGLTFYFGTKTRYEEVNPFLLE
NPLLVTGKQDLLPNMCTPIKIVSVIRHGTRYPTHKQIKKMKKMHDLIVRQEGIRSELVEE
LQRWDMWYEDWMDGQLVKKGEQDMSNLAYRLASLFPSLFTKDRLKQNNMTFTTSSKHRCV
DSTKSFISGLVHDYFGFPQAPESELKDLPYMEPVINDHLMRFFDHCPKFLAEVEDNDTAL
HEVDKFKQSPEMRKVINKIATLLDVPELDLSADLIQMAFFICSFELAIKNITDSPWCNLF
DQEDARVLEYLNDLKQYWKRGHGYDINSRSSCHLFQHIFQHLEAAVTESKSSQQVSMPVV
MQFGHAETLLPLLALLGLFKDETPLTAENFISQSERKFRSGHIVPYASNLAFVLHRCDMA
ETPRERYQVQLLLNEQLLHFPHSHNSLCLFDEMKEQYGHLLDGCQIAKECAIVKANRSSE
DEL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagttttctgttcgccgcttgcagaccgcataccccgaaacctttccagatcctcctt
ttctccatcacctggatttgcagctcgacgcgcacatccgtagggagccagcctcctggt
ttaactttttattttgggactaaaacaaggtatgaagaagtcaacccgtttctcctggag
aaccctctgctggtcaccgggaagcaggacctcctgcccaacatgtgtacccccatcaaa
atagtatctgtaatccggcacggcaccaggtaccccacccacaagcaaatcaagaagatg
aagaagatgcacgacttgatagtgcggcaggagggcatccggtcggaactggtggaggaa
ctgcagcggtgggacatgtggtatgaagactggatggatgggcagctggtgaagaaagga
gagcaggacatgagcaacctggcctatcgattggcctccttgttcccctcgctcttcaca
aaggacagattaaagcagaacaatatgaccttcacaacaagctcaaagcacagatgtgtg
gacagcacaaaatcgttcatcagcggcctcgtgcatgactattttggcttcccccaggct
cctgagagtgaactgaaagacctgccttatatggaaccagtcatcaatgaccatttgatg
cgtttcttcgatcactgccctaaatttctggcggaggtggaagacaatgacacggcgctg
catgaagtggataagttcaaacaaagcccagagatgaggaaagtgattaacaaaatcgct
actctcttggatgtgccggaactggatctctcagcggatttgatccaaatggcctttttt
atctgctcctttgaactggccattaagaatataacagattctccttggtgcaacctgttt
gatcaagaagatgccagggtcctagagtacctcaatgatttaaaacagtactggaagcgg
ggacacgggtatgatatcaacagccgctccagctgtcacctgtttcagcacatcttccaa
cacttagaagcggcagtcacagaaagcaaaagctcccagcaggtctccatgccagtggtc
atgcagtttggccatgccgagaccctcttgccgctgctcgctctcttgggcctgtttaag
gacgagactcccctgacggcagagaacttcattagccagagtgagcgtaagttccgcagt
ggccacatcgtaccgtacgcctccaacctggcctttgtgctgcaccggtgcgacatggcc
gagacccccagagagaggtaccaggtacaactgctgctcaacgaacagctccttcacttc
ccacattcccacaattcactctgcctctttgacgagatgaaggagcagtatggccacctc
ctggatggctgccagatcgctaaggaatgtgcaatagtgaaagccaaccgctcctcggag
gatgagctttaa

DBGET integrated database retrieval system