KEGG   Xenopus tropicalis (western clawed frog): 100493876Help
Entry
100493876         CDS       T01011                                 

Gene name
oxtr
Definition
(RefSeq) oxytocin receptor
  KO
K04229  oxytocin receptor
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04020  Calcium signaling pathway
xtr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100493876 (oxtr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100493876 (oxtr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xtr04030]
    100493876 (oxtr)
G protein-coupled receptors [BR:xtr04030]
 Rhodopsin family
  Peptide
   Oxytocin
    100493876 (oxtr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 DUF1294
Motif
Other DBs
NCBI-GeneID: 100493876
NCBI-ProteinID: XP_002936297
Xenbase: XB-GENE-484840
UniProt: F6R9M3
Position
4
AA seq 390 aa AA seqDB search
MEPLCAQPDCPLLLLNGSWGNFSMENRTGPTNTTRDPLKRNEDVAKVEVAVLALILFLAL
AGNICVLIAIHINRHKHSRMYFFMKHLSIADLVVALFQVLPQLIWDITFRFYAPDFVCRI
VKYLQVVGMFASTYMLLLMSLDRCLAICQPLRSLHRRSDCVYVVLTWILSFLLSVPQIHI
FSLKEVGNKVYDCSASFIEPWGLKTYITWITITVYILPVMILSVCYGLISYKIWQNIRLK
TMCESSVRLSSNKRATLSRVSSVRLISKAKIRTVKMTFIIVLAYIVCWTPFFFVQMWSVW
DPDAPKEDSLFIIAMLLGSLNSCCNPWIYMLFTGHLFHDLLQRFLCCSARYLKSSQQGSD
MSTSRKSNSSTFVLSRKSSSQKSITQPSIA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggagccgctttgcgcccagcctgactgcccgctccttctgctcaacggctcctgggga
aacttcagcatggagaacaggaccggtccgacaaacaccaccagggaccctctgaaacgg
aatgaagacgttgccaaggtggaagtggcagttttagcccttatcttattcttggccctg
gcaggcaatatctgcgtcctgatagcgatccacattaacaggcacaagcactcccgcatg
tacttcttcatgaagcacctcagcatcgcagacctggtggtggccctgtttcaggtgctg
cctcagctcatctgggacatcactttcaggttctatgctcctgactttgtctgtaggata
gtcaagtacctgcaggtggtggggatgtttgcctccacttacatgctcctgctgatgtcc
ctagacaggtgcctggctatctgtcagcccctgaggtccctccacaggagatcagactgt
gtctatgtggttctcacatggattttaagttttcttctgagtgtccctcagatccacatc
ttctccctcaaggaggtagggaataaagtgtatgactgctctgccagtttcattgagcct
tggggactcaaaacctacatcacctggataaccataactgtgtacatcttgccagtgatg
atcctcagcgtgtgctatggcctcatcagctacaagatctggcagaacatacggctgaag
accatgtgtgagagcagtgtgaggctgagttccaacaagagggccaccttgtccagagtc
agcagcgtcaggctcatctctaaagccaaaatcaggacagtcaagatgaccttcatcatt
gtgttggcttatatcgtgtgctggactccctttttctttgtccagatgtggtcagtgtgg
gacccagatgctccaaaggaagactctctgttcatcatcgccatgctcctggggagtctg
aacagctgctgcaacccgtggatctacatgcttttcactgggcacctcttccatgacctt
ctgcagcgctttctgtgctgctccgctcgttacctgaagtccagccagcagggcagcgac
atgagcaccagcaggaaaagcaactcttccaccttcgtgctcagccgcaagagttccagc
cagaagagcatcacccaaccttctattgcctga

DBGET integrated database retrieval system