KEGG   Xenopus tropicalis (western clawed frog): 100494097
Entry
100494097         CDS       T01011                                 

Gene name
kcnip3
Definition
(RefSeq) calsenilin isoform X1
  KO
K23855  Kv channel-interacting protein
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:xtr04990]
    100494097 (kcnip3)
Domain-containing proteins not elsewhere classified [BR:xtr04990]
 EF-hand domain-containing proteins
  Calcium binding proteins
   100494097 (kcnip3)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4
Other DBs
NCBI-GeneID: 100494097
NCBI-ProteinID: XP_002932578
UniProt: F6ZLJ4 F6QES3
Position
3
AA seq 284 aa
MLLRVAIVTHTQFQPPQQVCSTPCSAVHPVTMQDNIKENDGSLLGDPGQTSPEKKDGVKW
QKPRLSRRTLMKCCLVKWILSSTSPQGPDSSDSDIELSTVRHQPEGLDQLQAVTKFTKKE
LQSLYRGFKNECPSGLVDEETFKLIYSQFFPQGDATMYAHFLFNAFDMDRSGAIRFEDFV
IGLSILLRGTIHEKLKWAFNLYDINKDGYITKEEMLAIMKSIYDMMGRYTYPLLRDDAPI
EHVERFFQKMDRNRDGVVTIDEFLETCQKDENIMRSMQLFENVI
NT seq 855 nt   +upstreamnt  +downstreamnt
atgctgctgcgagttgccattgtcacacacacacagttccagcctcctcagcaagtctgc
agcaccccctgctccgctgtgcacccagtcaccatgcaggataacattaaggagaatgat
ggcagtttgctgggagaccctggtcagacttcccctgaaaagaaagacggtgtgaaatgg
cagaagcctcgcctgtcccgcaggaccctgatgaaatgctgcctggtgaaatggatactg
tccagcacttccccacaaggcccagatagcagtgacagcgatatagaactatccacagta
cgacaccagccggaggggctggaccaactgcaggctgtcaccaagttcactaagaaagaa
ctgcagtccctgtatagaggcttcaaaaatgaatgtcctagtggtttggttgatgaagaa
acgttcaagttgatctactcacagtttttccctcaaggagatgccacaatgtacgcgcac
tttctctttaacgcctttgacatggacaggagtggcgccattagatttgaggattttgtt
attggactgtctatcctcctgcgagggactatccatgaaaagttgaaatgggctttcaac
ctgtatgacattaacaaagacggctacatcaccaaggaggagatgctggccataatgaag
tccatctatgacatgatgggccgctatacctaccccttgctcagagacgatgcccctata
gagcatgtggagagattttttcagaagatggatcggaatcgtgacggggttgtgaccata
gatgaatttttggaaacatgtcaaaaggatgaaaacatcatgaggtccatgcagcttttt
gagaatgtcatttag

DBGET integrated database retrieval system