KEGG   Xenopus tropicalis (western clawed frog): 100494997Help
Entry
100494997         CDS       T01011                                 

Gene name
thbs2, tsp2
Definition
(RefSeq) thrombospondin 2
  KO
K04659  thrombospondin 2/3/4/5
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04145  Phagosome
xtr04510  Focal adhesion
xtr04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100494997 (thbs2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100494997 (thbs2)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100494997 (thbs2)
Membrane trafficking [BR:xtr04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100494997 (thbs2)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100494997 (thbs2)
  Exosomal proteins of colorectal cancer cells
   100494997 (thbs2)
  Exosomal proteins of bladder cancer cells
   100494997 (thbs2)
Glycosaminoglycan binding proteins [BR:xtr00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100494997 (thbs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 TSP_1 VWC EGF_3 EGF_CA Laminin_G_3 cEGF EGF
Motif
Other DBs
NCBI-GeneID: 100494997
NCBI-ProteinID: XP_017949682
Xenbase: XB-GENE-482462
Position
5
AA seq 1176 aa AA seqDB search
MLQRKLLLLHLLLSFSVSIYGQDEEKEDETNFDLFEISNINKRTIGAKIFRGHESSSPAY
RFLRFDHIPPINNEKMKQIIELMQQNEGFILTATLKQDKNNRGTIISIEGPGISNRLFEL
VSNGRANTLDLIYWVDGSQNVISLEDVDLADSHWKNITVQLLGENFNLYVGCDLIDSFQL
EETFYEHLKDDNIKMFLAKGSIRENHFRGLLQDVRLIFDVSVEDVLRKKGCQLTHTGEVN
AISEKTEILHLSPMTMTEYVGQKIDKQVDFCDHSCDELGNMFTELTRLRILVNNLLDNLQ
KVSEENQVLWELIGPNKTLKNQSMCWQDGRLFADNEDWIVDSCTKCTCQNSKTVCQQITC
PPVHCASPTFNEGECCPMCFPMDSEAGWSPWSEWTECSVTCGSGTQQRGRSCDATSSSCE
GSSIQTRTCNLGKCDNRIRQDGGWSHWSPWSACSVTCGIGNITRIRLCNSPKPQLGGKNC
TGAGRETKQCEGIPCPINGKWGPWSPWSSCTVTCGGGLRERSRLCNNPKPQYGGKKCGGE
PKEKEMCNKQDCPIDGCLSNPCFPGAECNSYPDGSWSCGACPVGFVGNGTFCEDIDECVL
VSDTCFRLGGVHRCVNTDPGYHCLPCPPRYKGTQPFGVGIEVAKKDKQECEPVNPCKDKS
HNCHKYAECIYIGHFSDPSYKCECRTGYAGDGIICGEDSDLDGWPNNNLVCAANATYHCV
KDNCPLLPNSGQEDFDKDGVGDACDKDDDNDGVDDEKDNCPLLYNPRQFDYDKDEVGDRC
DNCVYVHNPAQIDTDNNGEGDACAADIDGDDILNELDNCPYVYNTDQKDTDKDGVGDQCD
NCPLMHNPDQTDVDNDLVGDQCDNNEDIDEDGYQNNLDNCPYIPNANQADHDKDGRGDAC
DSDDDNDGVPDDRDNCRLVYNPDQKDSDGDGRGDACKDDFDNDSIPDILDVCPENSDISE
TDFRKFQMVPLDPKGTAQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFSAVDFSGTFYV
NTDRDDDYAGFVFGYQSSSRFYVLMWKQVTQTYWEDKPSRAYGYSGVSVKVVNSTTGTGE
HLRNALWHTGNTPGEVRTLWHDPKNVGWKDYTAYRWHLTHRPKTGFIRVVVYEGKQIMAD
SGPLYDKTYAGGRLGLFVFSQEMVYFSDLKYECKDF
NT seq 3531 nt NT seq  +upstreamnt  +downstreamnt
atgctacagagaaaattattgttgctacacctcttgttatcatttagtgtttctatctac
ggtcaagatgaagagaaagaagatgaaactaattttgatttattcgaaataagtaacata
aataaaaggacaattggagctaaaatatttcgtggacatgaatccagctctccggcatac
cgtttccttcgttttgatcacatccctccaattaataatgagaagatgaagcagataatt
gagctgatgcagcaaaatgaaggctttattcttacagccacattaaaacaagacaagaat
aatagggggactataatttccattgaaggtcctggtatctccaacagactctttgagcta
gtttctaatggacgagccaatactttggatctaatttattgggttgatggatctcaaaat
gttatatccttggaggatgttgacctggcagactcacactggaagaacattacagttcag
ttgttgggtgaaaactttaacctttatgttggctgtgatctgatagacagcttccaatta
gaggaaacattttatgagcatctaaaggatgataacatcaagatgtttttagccaagggt
tcaatacgtgaaaaccactttaggggactgcttcaagatgtgagactaatttttgatgtt
tcagttgaagatgttttgagaaagaaaggttgtcagcttacccacacaggtgaagtcaat
gccatcagtgaaaaaacagaaattcttcacctctctcctatgactatgactgaatatgtt
ggccagaagatagacaagcaggttgatttttgtgaccattcttgtgatgaattgggaaat
atgttcactgagctgaccaggctacgcattcttgtaaacaaccttctagataaccttcaa
aaagtgtctgaagagaatcaagtgttgtgggaactgattgggcccaataaaacgctaaag
aaccagtcaatgtgctggcaagatggacgtctttttgcagataatgaagactggattgtg
gacagctgcacaaaatgcacttgtcagaattcaaaaacagtttgtcaacaaattacttgc
cctccagtgcattgtgccagcccaactttcaatgaaggagagtgttgccctatgtgcttc
ccaatggatagtgaagctggctggtctccatggtctgagtggacagaatgttctgtgact
tgtggctctggaacacagcaacgaggaagatcctgtgatgccaccagcagcagttgtgaa
ggttcatctatccaaactaggacatgtaatctgggaaagtgtgacaaccgcatacgtcag
gatggtggttggagtcattggtcaccttggtcagcatgttctgtcacctgtggaattggc
aatatcacgcgtattcggttatgtaactcccctaagccacagctaggtgggaaaaactgc
acaggagctggacgcgaaacaaagcaatgtgaaggaatcccatgcccaataaatgggaaa
tggggaccctggtcaccttggtccagctgtactgtcacatgtggtggaggtctgcgagag
agatcacgtctgtgtaataaccccaaaccacagtatggtggaaagaagtgtggcggtgag
cctaaagaaaaggagatgtgcaataagcaggactgccctattgatgggtgtttgtctaat
ccctgctttcctggagctgagtgcaatagctaccctgatggatcgtggtcgtgtggagca
tgccctgttggttttgttggcaatgggacgttctgtgaagatatagatgagtgtgtcctg
gtatcagatacctgcttcagactggggggagttcatcgctgtgtgaatacagatccaggc
tatcattgcttgccgtgcccaccacgttacaaaggtacccagccttttggtgtgggcatt
gaagtagccaaaaaggacaaacaagaatgtgaacctgtaaatccatgcaaggataaaagt
cacaactgccacaaatatgcagaatgtatatacattggccactttagtgacccttcctac
aaatgtgaatgccgaacaggatatgctggcgatggtattatctgtggagaagactcagat
ttagatggatggcccaataataacttggtctgcgctgccaatgccacttaccattgtgtt
aaagataattgccctctcctgccaaattcagggcaagaggactttgataaggatggagtt
ggtgatgcttgtgacaaagatgatgacaatgatggcgtagatgatgaaaaggacaattgt
cccctgctttataacccacgtcagtttgactatgacaaagatgaagttggtgatcgctgt
gataattgtgtctatgtgcacaatccagcccagattgacacagacaataatggagaggga
gatgcatgtgctgcagatattgatggtgatgatatcttgaatgagcttgataattgccca
tatgtctacaataccgaccagaaagatactgataaggatggtgttggtgaccaatgtgac
aactgtccattaatgcacaatccagaccagactgatgtggataatgatttagttggtgac
caatgcgataacaatgaagacattgatgaagatggttaccagaacaatttggacaattgc
ccttacattcctaatgcaaaccaagctgaccatgataaggatggtagaggggacgcatgt
gattcggatgatgacaatgatggtgttcctgatgaccgagacaactgtcgacttgtttat
aatcctgaccaaaaggactctgatggtgatggtcggggtgatgcttgcaaggatgacttt
gataatgacagcataccagatatacttgatgtgtgccctgaaaacagtgacattagcgaa
actgacttcaggaaatttcagatggtacctctggatccaaagggaactgcacagattgat
cccaactgggtgattcgccaccagggcaaagaactggtacagacagccaactcagatcct
ggcatagctgtaggttttgatgaattcagcgcagttgacttcagtggtacattttatgtg
aacacagaccgtgatgatgactatgcaggctttgtatttggctaccaatccagcagcagg
ttctatgttctcatgtggaagcaggtcactcagacatactgggaggacaaaccatctagg
gcttatgggtattctggtgtgtctgtcaaggttgtaaactccactacaggaactggggag
cacttaagaaatgccctctggcatactgggaatacaccaggagaggtaagaaccttgtgg
catgatcccaaaaatgttggctggaaagattatactgcttacagatggcatctgactcac
agacctaagactggttttataagagttgtagtatatgaagggaagcagatcatggcggac
tcaggccctctttatgacaagacatatgctggtggacgactgggcctctttgttttctct
caagaaatggtttacttctctgatcttaaatatgaatgtaaagatttctaa

DBGET integrated database retrieval system