KEGG   Xenopus tropicalis (tropical clawed frog): 100495081
Entry
100495081         CDS       T01011                                 
Name
(RefSeq) zinc-alpha-2-glycoprotein
Organism
xtr  Xenopus tropicalis (tropical clawed frog)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 MHC_II_beta Psg1 ig I-set Marek_A TMEM154
Other DBs
NCBI-GeneID: 100495081
NCBI-ProteinID: XP_002940108
UniProt: A0A6I8QD81
Position
8:complement(134176923..134197639)
AA seq 339 aa
MARFTPLVFFIFSLGMSVVYCGSHLLQYHITRLTAPSPGLPELIKIGYVDGLRYARCTSE
THRCEFLIPALETVYERMTLKEKCINYFEFSQFERLQLLTDIYNKTSGNDAFHIYQMKFG
CVQHDDGTTGIYQEVAFDSKELITYDKHTGTFIPTSQEARIVAQLWNKNYAKVEKIYMEN
CCTPRLALFPPAIASDLEKKVPPKVKVSSSESDGEQKLHCRVYGFYPRDVEVKWIKNGRD
EIHSEEAAQILPNPDGTYQIRVSVGVTPEEGATYSCHIDHSSLENPLVVPFESKNGIHLY
IIIPVCAPLLLLLIILGICIYRKRMTQDPKGSYQSGSAS
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggctcgtttcactcctcttgtgttttttatttttagcctcgggatgtctgttgtctac
tgtgggagtcacctgctacagtatcacataacaaggctcacagctccgagccctggtctt
ccagaattaataaaaattgggtacgtggatggcttgcggtatgcccggtgcaccagtgag
acccatcgctgtgagttcttgattccagctctggaaacagtctacgagcgcatgacattg
aaggaaaaatgtatcaattactttgaattctcccaatttgagagactgcaattattaacc
gatatttataataagacgtctggtaatgacgcctttcatatttaccagatgaaatttggc
tgtgtgcagcatgatgatggtaccactgggatatatcaagaggtggcgtttgacagcaag
gagctgataacatatgataaacatacagggacttttatccctacatcgcaagaggctcga
attgttgcccagttgtggaataaaaattatgccaaagtagaaaagatatacatggaaaac
tgctgtactcctcgactggctttgtttcctcctgcaatagcaagtgatctggagaagaaa
gttcccccaaaagtgaaggtttccagctcagaatcagacggggaacagaagctgcactgc
cgggtgtatgggttctacccccgagatgtggaagtgaagtggataaagaatgggagagat
gagattcactcagaggaggcagcacagatcctgccaaaccctgatggcacctatcagatc
agagtcagtgtgggggtaacaccagaggagggcgccacttattcctgccatatagatcac
agcagcttggagaacccactggttgttccctttgaatccaagaatggaatccatttgtat
atcatcatccctgtctgtgcgcctttgctcctcctcctgattatcctgggaatatgtata
tatagaaagagaatgacgcaagaccctaagggcagctatcagagtgggagcgctagctag

DBGET integrated database retrieval system