KEGG   Xenopus tropicalis (western clawed frog): 100496569Help
Entry
100496569         CDS       T01011                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase-like
  KO
K09565  peptidyl-prolyl isomerase F (cyclophilin D) [EC:5.2.1.8]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100496569
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:xtr03110]
    100496569
Enzymes [BR:xtr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     100496569
Chaperones and folding catalysts [BR:xtr03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    100496569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 100496569
NCBI-ProteinID: XP_002932593
Position
3
AA seq 170 aa AA seqDB search
MENKRVFFDISANDIPLGRIVMELRFDVVPKTAENFLKLCTGECGFGYKGCTFHRIIPSF
MCQGGDFTNHNGTGGKSIYGGKFEDENFNLKHSTPGVLSMANAGPNCNGSQFFISTIKAE
WLNGKHVVFGHVVEGMEVVKKMESYGCNSGKTSKKILISDCGVLEESPSA
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggagaacaaacgagtgttttttgacatatccgcaaatgatattccccttggtcggata
gtgatggagctccggtttgatgtggtgcccaagactgcagagaactttctcaagctatgc
acaggggagtgtggcttcggttacaagggctgcactttccaccgcatcatccccagcttc
atgtgtcagggaggtgacttcacaaaccacaatggtactgggggtaagtccatctatggt
ggcaaatttgaggatgaaaacttcaatctgaagcacagtacaccgggtgtcctctccatg
gccaatgcagggccgaactgcaatggttcccagttcttcatctcaaccataaaagctgaa
tggctgaatggaaagcacgtggtgtttggtcatgtggttgaggggatggaggtcgtcaag
aagatggaaagctatggatgtaacagtgggaaaaccagcaagaagatacttatctctgac
tgtggggtccttgaagagtcaccctctgcgtga

DBGET integrated database retrieval system