KEGG   Xenopus tropicalis (western clawed frog): 100496768
Entry
100496768         CDS       T01011                                 

Gene name
erap1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xtr01002]
    100496768 (erap1)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     100496768 (erap1)
Peptidases and inhibitors [BR:xtr01002]
 Metallo peptidases
  Family M1
   100496768 (erap1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 100496768
NCBI-ProteinID: XP_002933475
Xenbase: XB-GENE-983344
UniProt: A0A5G3HER4
Position
1
AA seq 932 aa
MLSTAIKPRRIKDLPLCFVVVYLMCISFSIQPALAASKALDNAEMFPWKNLRLPTFAAPL
HYDLLIHPNLTTLTFSGLTKVTVTVTQKTSFLVLHSKHLEITKTTIKRKLGKDPVLQDLL
LREHPVNEQIALLAADPLIPGENYTIYIEYNANLSKNFRGFYKSTYKTKDGEVRVLASTQ
FEPTAARTAFPCFDEPAFKASFSIQIRREPKHHAVSNMPVVKTVNIGGGLLEDHFAASVK
MSTYLVAFIVSDFKSISQVTNHGVRISVYATPEKIDQAEYALKAAVKLLDFYEDYFNISY
PLPKQDLAAIPDFQSGAMENWGLTTYRESALLHDPKTSTASHKLWVTMIIAHELAHQWFG
NLVTMEWWNDLWLNEGFAKFMEYVSVRVTYPELQVEDYFLDKCFRAMDVDSLNSSHAVST
PVENPEEIQEMFDEVSYDKGACILNMLMDYMGAESFEAGIVDYLRRYSYRNARNEDLWNS
MTDVCPSDETNSGYCTKTRQTSHWSEGEIIDVKSMMNTWTLQKGFPLVTVTVKGKYVYLH
QEHYLKGSTDTEASGLLWHIPLTYITSKSNTVQRFLLMSKTDVLVLAEEVEWIKFNVGMN
GYYIVHYEGEGWDALIKLLQENHTAISSNDRANLINSAFQLVSIGRLPIDKALSLSLYLK
NEDKIMPVFQGMDELIPIYKLMEKRDMQEVESQMKKYILNLLRKLIDAQSWTDEGSVSER
MLRSSLLLFACVRQYQPCVQRAEQYFKRWQESNGTISLPRDVASAVYAVGAQTPEGWDFL
FEKYKTTLSGSEKNQIELALAITSLKHKLQWLMEEGMKGDHVRTQDLPHIVLYVSRNPVG
YPLSWEFLKNNWGNLVQKFELGSRTVGDMVVGITKQYSTKEWLEEVTGFFDSLKEMGSQL
RCVQQARETIEENIRWMDKNLDLVKSWLENNS
NT seq 2799 nt   +upstreamnt  +downstreamnt
atgctgagcactgctataaagccacgaagaataaaggacctgccattgtgctttgtggtt
gtgtatttaatgtgcatatctttcagtattcagcctgccttagctgctagcaaggcttta
gacaatgctgaaatgttcccttggaagaacctaaggttacctacatttgcagctcctttg
cactatgaccttctaatccaccctaatctaaccactcttacatttagtggcctcaccaag
gttacagttacagtaacccaaaaaactagctttttggtccttcatagtaaacacctggaa
attacaaagacaactataaagagaaaacttggaaaggatccagtgcttcaggacctattg
ctgcgagagcaccctgtgaatgagcaaattgcacttctggctgctgatccattgattcct
ggagaaaattatacaatctacattgaatataatgccaacctttcaaagaattttcgtggg
ttttataaaagcacctacaaaaccaaagatggagaggtcagagtacttgcatcaacccaa
tttgagccaacagcggcaagaacagctttcccatgtttcgatgagcctgccttcaaagct
agcttctcaattcagataagaagagaaccaaagcaccacgctgtgtctaacatgcctgta
gtgaagactgtgaatattggaggggggctgcttgaggaccattttgctgctagtgtgaag
atgagcacatacttagtggctttcattgtctcagactttaaatcaatcagtcaagtgaca
aatcatggagttaggatttccgtgtatgctactccagagaagatagatcaagcagagtat
gccctgaaggcagctgtaaaattgttggacttttatgaagactacttcaacatttcgtac
cctttgccaaaacaggatctggctgcaatacctgattttcagtctggcgctatggaaaac
tggggtctgacaacctacagggagtctgcgttgcttcatgatccaaaaacatcaaccgca
tcgcataaactctgggttactatgataatagctcatgagctggcacatcagtggtttggg
aatctggtaacgatggaatggtggaatgacctttggcttaatgaaggctttgctaagttt
atggaatatgtttctgtcagagttacctatccagagctgcaagtggaggattatttcctg
gacaaatgctttcgggctatggatgttgactcactgaactcctctcatgctgtatctaca
cctgtggagaatccagaagagatacaagaaatgtttgatgaggtctcatatgataagggt
gcttgcattcttaatatgctgatggactacatgggtgcagaaagctttgaagctggaatt
gtggattatttacgtcgttatagttaccgcaatgctaggaatgaagacctgtggaacagc
atgacggatgtttgcccttcagatgagacaaacagtggatattgtacaaagactcgccaa
acatctcactggtctgaaggtgaaattattgatgtgaagtcaatgatgaatacttggact
ttacaaaaaggtttcccattggtgactgtaacagtgaaagggaagtatgtttatctccat
caggagcattatctcaaagggagcactgatactgaagcttctggattactttggcatatc
cctttgacgtacatcacaagcaaatctaacacagtgcaaagatttctgctgatgagtaaa
acagatgtcctagtcctggcagaagaggtggaatggataaagttcaatgtggggatgaac
ggttattacatagtacattatgaaggggaaggttgggatgcactgattaagctcttacag
gagaaccacacagctattagcagcaatgaccgcgccaatctcattaacagtgctttccag
ctggtaagcattgggcgattgcccattgacaaagctctcagcctttctttgtatttgaaa
aacgaagacaaaatcatgccggtgttccaagggatggatgagctgattccaatatacaaa
ctaatggagaagagagatatgcaggaagtagaaagtcaaatgaagaaatatattctcaat
cttctgcgcaagttgattgatgcccagtcctggacagacgagggcagcgtttctgagagg
atgctgcgcagctcgctcctcctgtttgcctgtgtgcgccagtaccagccgtgtgtgcag
agggcagagcaatattttaagagatggcaggagtccaatggaacaataagcttgccgcgg
gatgtcgcatcggctgtttatgctgtgggggcgcagactcctgaaggatgggactttctc
tttgagaaatacaaaacgactctgtccgggagtgaaaagaaccagattgaattagccctg
gctatcacttctcttaaacataagttacaatggctgatggaagaagggatgaaaggggat
catgtcagaactcaagacctcccccatattgttctgtatgtgagcaggaacccagtgggt
tatccattgtcctgggagtttctaaagaacaactggggcaacctggtgcaaaagtttgag
ctgggatcgcgtacagttggcgacatggttgtgggaatcacaaagcagtattcaactaaa
gagtggctggaagaggtcacaggattctttgattcattaaaggaaatgggctcccagctc
cgctgcgttcagcaagccagagagacgattgaagagaacattagatggatggataagaac
ttggatcttgttaaaagctggttagagaataacagctag

DBGET integrated database retrieval system