KEGG   Xenopus tropicalis (western clawed frog): 100497212
Entry
100497212         CDS       T01011                                 

Gene name
adcy4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00230  Purine metabolism
xtr01100  Metabolic pathways
xtr04020  Calcium signaling pathway
xtr04114  Oocyte meiosis
xtr04261  Adrenergic signaling in cardiomyocytes
xtr04270  Vascular smooth muscle contraction
xtr04371  Apelin signaling pathway
xtr04540  Gap junction
xtr04912  GnRH signaling pathway
xtr04914  Progesterone-mediated oocyte maturation
xtr04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100497212 (adcy4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100497212 (adcy4)
   04020 Calcium signaling pathway
    100497212 (adcy4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100497212 (adcy4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100497212 (adcy4)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100497212 (adcy4)
   04914 Progesterone-mediated oocyte maturation
    100497212 (adcy4)
   04916 Melanogenesis
    100497212 (adcy4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100497212 (adcy4)
   04270 Vascular smooth muscle contraction
    100497212 (adcy4)
Enzymes [BR:xtr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100497212 (adcy4)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053
Other DBs
NCBI-GeneID: 100497212
NCBI-ProteinID: XP_002934331
Xenbase: XB-GENE-984909
UniProt: F7DFA1
Position
1
AA seq 1072 aa
MPENSQTQLGHYRQRCEKEGPLYETYYRLTQQYPVILLLLLIVLAVCCALIIITFATGRT
FSDNVGFLVTLFCALGVFSILFIPVCIKKVVQKCMQIIGVVILGCLVTLGYVFIFTSGLV
SAWDQIYWTLFVIISLYTMLPLGMKWAIFAGLSCFVAHIIVLSVYVSTVRLLPRDDVALQ
MIADAVILLCGNVIGGYHKCVTESALKDTYHEAINFIHSRLKLVSQERQQERLLLSILPA
YIATEMKAEIIERLKEKRPQPENTNNFHNLYIKRHKDVSILYADIVGFTLLSSECSPKEL
VLMLNELFGKFDQIAKDNECMRIKILGDCYYCVSGLPEFLPNHAKNCVLMGLDMCQAIRK
LRKATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITEAT
LSHLENEYEVEDATLAQRDLYLKENNIKTYLVIDPRANDGEAEDILPSKSAEVPKMRASV
RMTRYLESWGAEKPFAHLSHRDSLVPEPHSISHSMDLPMSPLSQTWSQEKSRSTRETNES
LNDNNFHIMEVLASQRQWKRSKDFNRITLYFNDKAAEKEYRLSDLPSFKYYTACCFFIFA
CNFIVQILVSHKNAAFGISYGISFFFFLLLLFTCFAGHLARCILKGPQLLHWLPSLSIAL
SSRPWLRVPLGVFTILTVLVMAVFNLFFLPDNNCPQQSWNSSLSPDPEPQMLYSLPYYMY
CCILGLLACSAFLLMNFEAKLILLSIALVIYNVIFLETHSWLSDCYVNWLYMNHSRPGIL
KEPKVMGSISLFIFFFTLLALSRQNEYYCRLDFLWKRKFKMERERIETMENLNRVLLENV
LPADVAQQFIGQNRRNEDLYYQSYDCVCVLFASIPDFKEFYTECDENHEGLECLRLLNEI
IADFDELLSKPKFSSVEKIKTIGSAYMAATGLNATSGQENPQDGDRNYNHIGIMVEFAIA
LIGKLDLINKHSFNNFKLRVGINHGPVVAGVIGAQKPQYDIWGNTVNVASRMDSTGVLGK
IQVTEETTKVLEKLGYKCERRGVIKVKGKGQLCTYFVSTDMARSGSQGNVLN
NT seq 3219 nt   +upstreamnt  +downstreamnt
atgccagagaatagccagactcaactagggcactaccggcagagatgtgaaaaagagggg
cctctatatgagacatattatcgcttgacccagcagtacccagtcatcttgctcctgctg
ctcatcgtactagcagtatgttgcgccctcattatcatcacatttgccaccggtcgaaca
ttctcagacaatgtcggcttccttgtgactctcttctgtgcccttggtgtgttcagtatt
ctcttcatcccagtgtgcataaaaaaggtggtgcagaaatgcatgcagatcataggtgtc
gtcatcttgggatgcctggtcaccttgggttatgtatttatcttcaccagtggccttgtc
agtgcgtgggaccagatctactggacactgtttgtgattatcagcttgtacaccatgctc
cctttgggcatgaaatgggctatatttgccggacttagctgcttcgttgcacatataatt
gtgttgagcgtctatgtgtctacagtaaggcttcttcctagagatgatgttgctctgcag
atgatagcagatgcagttatcttgctgtgtggaaatgtaatagggggttatcacaagtgt
gtgacagaaagtgccctaaaggacacttaccacgaggctatcaacttcattcactctcgt
cttaaacttgtctcccaagaacggcagcaggagcgcttgctactctccattctccctgca
tatattgcaactgagatgaaggctgaaatcatagagagactgaaagagaagaggccccaa
ccagaaaataccaacaatttccataacctgtatatcaagagacacaaggatgtaagcatt
ctgtatgcagacattgtgggctttacactcctctccagtgagtgctcacccaaggagttg
gttcttatgttaaatgagctcttcggaaagtttgaccaaattgcaaaagataatgagtgt
atgcgcatcaagattctaggagactgctattactgtgtgtcaggcttgcctgagttctta
ccaaaccacgcaaaaaactgtgttctgatgggattagacatgtgccaagctatacgcaag
ctgcggaaagccactggtgttgatattaacatgcgtgttggggtacattctggaaatgta
ctttgtggggtaattggcctgcagaaatggcaatatgatgtgtggtcacatgatgtaacc
ctagctaatcacatggaggctggaggagttccagggagagtgcacatcacagaagccact
ctgtcccatttagaaaatgaatatgaggtggaagacgcaacattggcacagcgagacctc
tatttgaaagagaataacataaagacctatctagtaattgaccccagggcaaatgatggt
gaggcagaggatattctgccatcaaaatctgccgaagttcctaagatgagggcatctgtt
cgcatgactcggtatctagaatcctggggggctgaaaagccctttgctcacctcagccac
cgtgacagccttgtgcctgaaccgcacagcatctcccacagtatggatcttccaatgtcc
ccattatcacaaacctggagccaagaaaagtcacgatctacaagagaaactaatgaatca
ctgaatgacaacaattttcacatcatggaggtgctggcctctcagaggcagtggaagagg
tcaaaggattttaaccgtataactctgtacttcaatgataaagcagctgagaaagagtac
cgcctctcagatctaccttcatttaagtattatactgcttgctgtttcttcatcttcgca
tgtaacttcattgttcagattctggtgtctcacaaaaatgcagcctttggaatctcgtac
ggaatttccttcttcttcttcttattacttctctttacatgttttgccggacatctggcc
agatgtatcctgaagggtccccagctccttcattggctgccatccctttccatagctctg
tccagtaggccttggctgagggtgccactaggggtcttcactatacttactgtgctggtt
atggcagtcttcaatttgtttttcctaccagataataactgtccacagcaatcttggaat
tcttccctgtcaccagatccagaacctcagatgctctatagccttccgtattatatgtat
tgctgcattctgggactactcgcctgctctgcctttctgcttatgaactttgaagccaag
ttgattctgctaagcattgctttggtgatctacaatgtcatcttcttggaaacacacagc
tggctgtctgactgttacgttaactggctgtatatgaaccacagcaggcctggaatcttg
aaggagccaaaggtcatgggaagcatctccttgttcatattcttctttacccttctagca
ttgtcaagacagaatgagtattactgccgtctagacttcctgtggaaaaggaaatttaag
atggagcgtgagcggattgaaaccatggagaatctcaatagagttttgcttgagaacgtt
ttgccagcagatgtagcccagcaatttattggacagaatcgaagaaatgaggacctgtat
taccagtcatatgactgtgtctgcgttttgtttgcctccatccctgactttaaggaattt
tacacagagtgcgatgagaatcatgaaggcttggaatgtctaaggctgctcaatgagatc
atagcagacttcgatgagctgctctcaaagccaaaatttagtagtgtggagaaaataaag
accattggtagtgcatatatggcagcaacaggacttaatgctacatcggggcaagagaac
ccacaggatggagacaggaattacaatcacatcggtatcatggtggagtttgccattgct
ttaattggaaagctggatctaatcaataaacactcatttaataatttcaaactgcgagtt
ggcattaaccacggtcctgtagtagctggagttataggagcccaaaagccacagtatgat
atatggggtaacacagtaaatgtagccagccgtatggacagcaccggtgtgttgggtaaa
atccaggtaacagaagaaaccaccaaagtcctagaaaagctgggatataaatgtgaacga
cgaggagttatcaaggttaagggtaaaggacagctctgcacctattttgtatccactgat
atggcacggtcaggttcccagggcaatgttttaaactag

DBGET integrated database retrieval system