KEGG   Xenopus tropicalis (western clawed frog): 101730890
Entry
101730890         CDS       T01011                                 

Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xtr01009]
    101730890
Protein phosphatases and associated proteins [BR:xtr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     101730890
SSDB
Motif
Pfam: WSK Csm1 DUF2141
Other DBs
NCBI-GeneID: 101730890
NCBI-ProteinID: XP_004917258
Position
8
AA seq 461 aa
MSECKGDSSGATKEETERGSLPPSVDLMGKVDGSTKSSKGYSAIVFLGKGKEKKYGHNLS
KDLKENEKKKPLVNSSVTKKCEALCFEEASNEFTCSSSITESYQLSTNKEAKYCFRKLDD
GTYAMEKIEELNPDESMPRKKSTKRGQQKGRYSHKPLKICFKKRSKALRKTSDSNDDYKS
ENKKVNYTNQYEAHTSVLENQYEFTQRGKTWATFKRLVTHKKKRHSSLKQQSQMNSQNHE
TNSNNSVSKKKRFSNIRLSCMNFSRGKEGATSSMPPQDALCAAESQEYEYDCKRSDKALA
IKYKLQRSLDAENGKIDSNIDQCMYMPTDEFQSLPKLKRVMNHLTQGADKRNLHKSLRKT
NVESVRSSILEEREAPGLSGSSKEGIKPKAETPEGGNMHESYKNNLNDCDDRLRHDDDAI
SRSPLISDPYETLLITTAATLVKKVLQASIQQLVDEGSMFQ
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtcagaatgcaaaggagattcttcaggtgccacaaaagaagaaacagaaagggggagt
ctacctccatctgtggacttgatggggaaagtagatggaagtacaaaatcttccaaaggc
tattctgccattgtgtttcttgggaaaggtaaagaaaaaaaatatggccataacctatcc
aaggaccttaaagagaatgaaaagaagaagccactagtaaatagttctgtcaccaaaaaa
tgtgaagctctttgttttgaagaagcctccaatgagtttacctgcagctcttccattaca
gagtcctatcagctgagtaccaataaagaagcaaagtattgcttcagaaaactcgatgat
ggaacatatgccatggagaagatagaggaattaaatcctgatgagtcaatgcctaggaag
aaatccacaaaaaggggtcaacaaaaaggacgctattcacacaagccattaaaaatctgt
tttaagaaacgaagcaaggctcttagaaagacttcagattcaaatgatgattataaatca
gaaaataaaaaagtgaattatacaaaccaatacgaagcgcacacttcagtattagagaat
caatatgaatttacacaacgtggaaagacatgggcaacatttaaaaggttggtaactcat
aaaaagaaacgccattcatctctaaaacaacagtcccaaatgaacagccaaaaccatgaa
acaaactcaaacaacagtgtttccaaaaagaaaagattctcaaacataagactctcgtgt
atgaacttctccagagggaaagagggtgcgaccagcagcatgccaccacaagatgcactt
tgcgcagcagaatcacaagaatatgagtatgactgtaaacgaagtgataaagcacttgca
atcaagtataaacttcaaagatccttagatgctgaaaatggaaaaatcgatagcaatatt
gatcagtgcatgtatatgcctactgatgaattccagtctttaccaaaactcaagagagtt
atgaatcatctgacacaaggggcagataaaagaaatctgcataaatcacttagaaaaaca
aatgtggaaagtgtcaggagctctattctggaagaaagggaagccccgggtttgtcaggc
agtagcaaggaaggaataaaaccaaaggcagaaactccagagggtggcaacatgcatgaa
agttacaagaataatctcaatgactgtgatgatagattgaggcatgatgatgacgcaata
agcagatctccattaatatcagatccatatgagactcttttaatcacaacagctgctact
cttgttaaaaaagtgctccaggcctctatccagcagctggttgatgaagggtccatgttt
caataa

DBGET integrated database retrieval system