KEGG   Xenopus tropicalis (western clawed frog): 101731867Help
Entry
101731867         CDS       T01011                                 

Gene name
dusp10
Definition
(RefSeq) dual specificity phosphatase 10
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101731867 (dusp10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xtr01009]
    101731867 (dusp10)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101731867 (dusp10)
    3.1.3.48  protein-tyrosine-phosphatase
     101731867 (dusp10)
Protein phosphatases and associated proteins [BR:xtr01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    101731867 (dusp10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc PTPlike_phytase Init_tRNA_PT Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 101731867
NCBI-ProteinID: XP_012818730
Position
5
AA seq 422 aa AA seqDB search
MPPSPLDDRVIVALSRPVRPQVLNLCLDSSYFESSSILSDSHKSLLSTSVVCLNAANLTY
MPSSTSSARSLGCGCSSASCCTVASYDKDSQSQAVSSTTITSGVSGPSASSSANQMVNNN
ENSGAKFIRKPHLGNQTSDKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDDN
TNEPSRVMPTQPLHTVLESLKREGKEPLVLKGGLSSFKQNHESLCDNSLQLQDCSDGGGA
SAVSITLPQSIPTTPDIENAELTPILPFLYLGNEHDAQDLETMQTRNISYIVNVTTHLPL
YHYEKGVFNYKRLPATDSNKQNLRQYFEEAFEFIDEAHQCGKALLIHCQAGVSRSATIVI
AYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGITPRILTPKLVGVET
VV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcctccttccccattagacgacagggttatagtggcactttccaggccagttcgacct
caggttcttaacctttgtttagactcttcctattttgaaagctcttccattctcagcgac
agccataagtcccttctcagcacgagtgtagtgtgtctcaacgctgctaacctgacgtat
atgccctcatccaccagctcggcacgctctcttggttgtggatgtagcagtgccagctgt
tgtactgtagcctcgtatgacaaggatagccaaagccaggcagtgagcagcacgaccatc
acaagtggcgtttctggaccgtcagcctctagctctgccaaccaaatggtcaacaataat
gagaacagtggtgctaagttcatccggaagccccatttgggcaaccaaacatccgataaa
atcagccggaggcgacttcagcagggaaagataacggtactggatttaatatcctgcagg
gaaggcaaggactctttcaagaggatcttctccaaagaaattatagtttatgatgataac
accaatgaaccgagcagggtaatgccaacccagccgctccacacggtgctggagtcactg
aaaagagaaggcaaggaaccccttgttttgaaaggtgggctcagcagtttcaagcagaac
cacgaaagcctctgtgacaattccctccaacttcaagattgttccgatgggggaggagcg
tccgccgtgtcaatcactctacctcagtccatccctaccacccccgacatcgagaacgca
gagctgacccccatcttgcccttcctttacctcggaaacgagcacgatgcccaggacttg
gaaacaatgcaaacacggaacataagttatattgtcaacgtcaccacccacctcccactc
taccactatgagaaaggggtcttcaactacaagcgtcttcccgccaccgacagcaacaag
cagaatctcaggcagtacttcgaagaggcgtttgagtttatcgacgaagcccaccagtgt
ggaaaagctcttctcatccattgccaagcaggcgtctcccgttcggccaccatcgtgatc
gcgtacctgatgaagcacacgcggatgacaatgacggacgcctacaagtttgttaaggga
aagcgaccaatcatttctccgaacctaaacttcatggggcagttactggaatttgaggaa
gacctaaacaatggaattacacctcggatccttacgccaaagctggtcggggtggagact
gtggtctag

DBGET integrated database retrieval system