KEGG   Xenopus tropicalis (western clawed frog): 101732970
Entry
101732970         CDS       T01011                                 

Gene name
ankrd53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xtr03036]
    101732970 (ankrd53)
Chromosome and associated proteins [BR:xtr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    101732970 (ankrd53)
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank Ank_3
Other DBs
NCBI-GeneID: 101732970
NCBI-ProteinID: XP_004916485
Xenbase: XB-GENE-991495
Position
1
AA seq 444 aa
MSHSLSIQAQNSASSNGILTRDQLSAAALGNDDWLQVSLKAANSEVKVDRHGFTALHLAA
LYGRLSCMKLLVEKYKMSVDLANHYGLTPLHLALDMKTGPRALECVQYLLERGAKVNVQT
KSGLTPLHQAAKEGRQDCITLLVEAGADVHAKDSQGQTPFDLCKIWSHKACARFLRYKMW
EKQKHDLSHEMKKMEKLKKDIIASEKETLSRIKKDHEVIQHLHFCEWLDKKGLPEKLKES
ARSQTQTSSKSSGYRKGSGEQCNKSLSSKTPKRAVLPSARSHKWKDHSNSQHSVTKENQS
HGKKELKRWNSSVKPSRPPITEISRDFQDLQSAHSEEFSSEDLGSYVLLSKDERGLPRIN
TISGKEVSPVPNLPFEMIERSLFPGSVPHQRLLSPKNFTANHILDVPRKQLPSNAQRPKS
EISYHLQQKVDPNYLKLTNNFLSL
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgtctcattctctgagcatccaggcacagaactctgcttcaagcaatgggattctaacg
agagaccagctatcagctgccgcccttgggaatgacgactggctgcaagtcagcctaaaa
gcagcaaattcggaagtaaaagtggaccgacacgggtttacagctctgcatttggcagcg
ctttatggtaggctatcatgtatgaagctgttagttgaaaagtataagatgagcgttgac
ttggccaatcattatgggttgacacctctccatttggccttggacatgaagactggacct
cgggcgcttgagtgtgtgcagtatttattggaacgtggagccaaggtcaatgtgcaaacc
aagagtggcctgacgcccttacaccaagcagccaaggaaggacggcaggattgtatcacg
ttactagtggaagctggagcagatgttcacgctaaggattcccaaggccaaacacctttt
gatttgtgcaaaatatggtcccataaggcttgtgctaggttcctccgttacaaaatgtgg
gagaaacaaaagcatgacctttctcatgaaatgaagaaaatggagaaactcaaaaaagat
attattgcctccgagaaagaaaccctctccagaataaagaaagaccatgaagtcattcag
catttgcatttttgcgaatggcttgataagaagggcttaccagagaagttaaaagaatca
gctcgtagccagactcaaacctcctcaaaatcaagcggctataggaagggctctggtgaa
cagtgtaacaaatcattatcttcaaaaactcctaaaagagctgtcctaccatcggcacgt
tcccataaatggaaagatcactccaattcacagcactctgttacaaaagaaaaccagtca
catgggaagaaggaattaaaaagatggaattcaagtgtcaagccttccaggccaccaatc
acagagatctcaagagatttccaagatttgcagagcgctcattccgaggaattctccagt
gaggatttaggttcctatgtgctccttagtaaagatgaacgtggacttccacgaattaat
acaatcagtgggaaggaggtttctcctgtccctaatttgccatttgagatgatagaaagg
agcctctttcctggttctgtaccacaccagaggttactctccccaaaaaacttcaccgcc
aaccatattttggatgttcccaggaagcagctaccttctaatgctcaacggccgaagtca
gaaatttcttaccatttgcaacaaaaggttgatcccaattacttaaagttaaccaacaat
tttctgtctctttaa

DBGET integrated database retrieval system