KEGG   Xenopus tropicalis (western clawed frog): 101734935
Entry
101734935         CDS       T01011                                 

Gene name
plcb2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00562  Inositol phosphate metabolism
xtr01100  Metabolic pathways
xtr04020  Calcium signaling pathway
xtr04070  Phosphatidylinositol signaling system
xtr04261  Adrenergic signaling in cardiomyocytes
xtr04270  Vascular smooth muscle contraction
xtr04310  Wnt signaling pathway
xtr04371  Apelin signaling pathway
xtr04540  Gap junction
xtr04621  NOD-like receptor signaling pathway
xtr04912  GnRH signaling pathway
xtr04916  Melanogenesis
Module
xtr_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101734935 (plcb2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101734935 (plcb2)
   04371 Apelin signaling pathway
    101734935 (plcb2)
   04020 Calcium signaling pathway
    101734935 (plcb2)
   04070 Phosphatidylinositol signaling system
    101734935 (plcb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101734935 (plcb2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101734935 (plcb2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101734935 (plcb2)
   04916 Melanogenesis
    101734935 (plcb2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101734935 (plcb2)
   04270 Vascular smooth muscle contraction
    101734935 (plcb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xtr04131]
    101734935 (plcb2)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101734935 (plcb2)
Membrane trafficking [BR:xtr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101734935 (plcb2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101734935 (plcb2)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y C2 EF-hand_like DUF1154
Other DBs
NCBI-GeneID: 101734935
NCBI-ProteinID: XP_017952419
Xenbase: XB-GENE-6045997
UniProt: F7AXY0 F6VSL4
Position
8
AA seq 1250 aa
MSMITPILPPVEVKSYLSKGERFIKWDDETSLASPVILRVDPKGYYLYWTFQSKEMEFVE
LTSIRDTRFGKFAKAPKSQKLREVFNLDFPENNFLAKALTIVTGPDMVDLTFHNFVSYKE
NVGKAWAADILSVVTNPLVPNACRYSFFEKIHVKLQLQLNSEGKIPVRNFFQMFPADRKR
VEQALNSCHLSKGKNDAINPEDFPESVFRTFLMQLCPRPEIDEIFTSYHSKAKPYMTKVH
LTKFINQKQRDSRLNELIFPPAKTEQVQGLIEKYEPSVINVQRGQLSPEGMVWFLCGSEN
SITSLDKIPIYQDMSQPLSHYFINSSHNTYLTAGQFSGVSSPEMYRQTLLSGCRCVELDC
WKGKPPEEEPIITHGFTMTTEILFKDVIEAIAESAFKTSPYPVILSFENHVDSPKQQAKM
AEYCRTIFGDMLLTDALEKYPLKPGNLLPSPQELLGKILIKNKKNQSFANQDKKANSCDS
TSSEQTSSLSSDNSGEGPEEGKEAENEEMTENADEEEMKQMQSDEGTASQEATAYEEMSS
LVNYIQPIKFDSFEVSAQKNQSYVVSSFVETKAYELLTKFPVQFVEYNKRQMSRIYPKGT
RMDSSNYMPQMFWNAGCQMVALNFQTMDIPMQQNMALFQFNGCSGYLLKHEFMRRGDKQF
DPFTVDRIDVVVANTVSITILSGQFLCEKCVKTYVEVELFGLPGDPKRKYKTKVTSVPNT
INPVWKEEPFVFEKILMPELASLRVAVFEEGGKFIGHRIIPIDLIRSGYHHICLRSESNM
PLTMPSLFVYVEVTDYVPDVWADLSQALSNPIKHSKANECKSMKVKTAPSGEISSASKPN
GIPGQNGPKGLPTSGVQDAAKEITEPQTANEEELQKQKGFLKLQKKQEKELKELERRTLK
RREEIVQKYTSAFSELYTQANKRKNSLPKGQKKKSIPDDDYGSVWGAGEIPGKGDPQVLE
MKRKMEEELTCLGEEQYETILKKKEQHSNEQISKLIELAQERQVAELKILKEAADSDTKQ
MKKKLEIKRLERLECMSKNTMEKASQERLKKEINNSHIQEVVQVLQLVSDKWAKNQQKLE
EKQAEGLQRIKEREDQVQKELQEEYIEKLNSLAAEVRDLVYNTMVTWFPTEAKSLKKEPK
SSAAEKWEALVAKVSHVETFVSSLTGENKAKTKDLEHDKLSAMGLVWDGTPASDPARNGT
STESVLSDTQDPVIKHTCPINTDKADALEQCSPSNEERREEEPEEMVSIH
NT seq 3753 nt   +upstreamnt  +downstreamnt
atgtctatgataactcccattctccctcccgtggaggtcaaatcctacctgtccaaagga
gaacgcttcatcaaatgggatgatgaaacatcacttgcatctcctgttatactacgtgtc
gatcccaagggctattacttgtactggacgttccaaagcaaggaaatggaatttgtcgaa
cttacaagcatcagagataccagatttggaaaatttgccaaagctccaaagagccagaaa
ctacgagaggtctttaacttggactttcctgagaacaacttccttgccaaagccctcact
attgtaactgggcctgacatggtggatctgactttccataattttgtctcctacaaggaa
aatgttggcaaggcatgggccgcagatattctgtcagttgtcacaaacccgctggtgcca
aacgcatgccggtattccttttttgagaagatacatgtcaagctgcagctacaactgaat
tccgaggggaagattcctgtgcgcaatttttttcagatgtttcccgctgacaggaagaga
gtggaacaagcgctaaactcctgccacctatcaaagggcaaaaatgatgcaatcaaccca
gaggatttccctgaatccgtcttcagaacgttcctcatgcagctctgccctcggcctgag
attgatgagatctttacctcttatcactccaaggccaaaccctacatgaccaaggtccac
ctcaccaaatttatcaaccagaagcagagggattctcgcctgaatgagcttatttttcct
cctgcgaagacagagcaagtacaagggcttatagagaaatatgaacccagcgtgattaat
gtgcagagaggacagctgtctccagaaggaatggtctggttcctctgtggctctgagaac
agcattacgtctcttgataaaatccccatctaccaagacatgagccaacctctgtcccac
tacttcatcaactcctctcacaacacatacctcacagctggtcagttttctggagtgtcg
tcacctgaaatgtacagacagacgctgctttctggctgtcgttgtgtggagcttgactgc
tggaaggggaagccaccagaggaagagccaatcattactcacggcttcacaatgaccact
gagatcctcttcaaggatgtcatcgaagccattgcagaatctgctttcaaaacgtctcct
tatcctgtgattctgtcttttgagaaccacgttgattctccaaagcaacaggcaaaaatg
gcagagtattgccgaactatttttggagatatgctgctgacagatgcactggagaagtat
ccgttaaaaccaggaaacctattgccgagtccccaggagctgctgggaaagatcctgata
aagaataaaaagaatcagtcctttgcaaaccaggataaaaaagcgaattcctgtgattcc
acctcctcagagcagactagttccctttctagtgacaattcaggtgaggggccagaagag
gggaaagaggcagaaaatgaggaaatgacagaaaacgcagatgaagaagagatgaagcag
atgcagtcagatgagggcactgcaagtcaggaggccacagcttatgaggaaatgtcaagt
ttggtcaactacattcagccaatcaaattcgactcctttgaagtctcagcacagaagaac
caaagttacgtggtgtcttcgttcgtggagaccaaagcctatgagttactcaccaagttt
cccgtgcagtttgttgaatataacaagagacagatgagccgcatttatcccaaaggcacc
aggatggactcctcaaattatatgccccagatgttttggaatgccggctgtcagatggtg
gcactcaacttccaaaccatggacatacctatgcaacagaacatggcgctgtttcagttt
aatggctgcagcggttaccttctgaaacacgagtttatgcgtcggggtgataaacaattt
gacccatttacggttgatcggattgatgtagtggtggccaatacagtttccataacaatc
ctttcaggacagttcctctgtgaaaaatgcgtaaagacctacgttgaagtcgagttgttt
gggctgcctggggaccctaagcggaaatacaaaaccaaagtaacatctgtgccaaatacc
attaacccagtgtggaaagaggagccgtttgtgtttgaaaagatcctcatgccagagttg
gcttcccttagagttgcagtatttgaggaaggggggaagtttattggccatcgaatcatt
cccattgatttaatccgatcaggataccatcacatttgccttcgaagtgagagtaacatg
ccccttaccatgccctctctctttgtgtatgtggaagtgacagactatgtaccagatgtc
tgggcagatctcagtcaggccttgtcaaaccccatcaaacactctaaagccaatgaatgc
aagtcaatgaaagtaaaaacagcaccttctggggagatctccagcgcttcaaaacccaat
ggtatccctgggcaaaatgggccaaaaggtttgcccaccagtggggtacaggacgctgct
aaagaaattacagagccacaaactgccaatgaggaggagctgcagaaacagaagggattc
ctaaagcttcagaaaaagcaggagaaagaactgaaggaactggagcgcaggactctaaag
aggagagaagagattgtacagaaatataccagtgccttctctgaactctacactcaggct
aacaaaaggaaaaacagcttacctaaggggcagaaaaagaagagtattcctgatgatgat
tatggctcagtgtggggagctggagaaatacctggcaaaggggacccccaggttctagag
atgaagaggaagatggaagaggaactgacatgtcttggggaggagcagtacgagactatt
ctaaagaaaaaagagcagcattctaatgagcaaatctccaaactgattgaactggcacaa
gagaggcaagtggcggaactaaaaatcctcaaggaagctgcagacagtgatactaaacag
atgaagaagaagttggagataaagaggttggaaaggctggagtgtatgagcaaaaatacc
atggaaaaagcttcccaggaaaggttaaaaaaagaaataaataactcccatatccaagaa
gtggtgcaggttctacaactggtatctgacaaatgggccaaaaaccaacaaaagctagag
gaaaagcaagccgaaggtctgcaaaggatcaaggaaagggaagatcaggtgcaaaaggaa
ctccaggaagaatacatagagaagctaaattcattggcagctgaagtgcgagacttggtg
tataacactatggtgacctggtttcccactgaagcaaaaagtctgaaaaaggagcccaaa
agttctgccgcggagaaatgggaggctctagtagctaaagtaagccacgtagaaaccttt
gtgtccagcctaactggggaaaacaaggcaaagacaaaggatttagaacatgataaatta
tctgcaatgggcctagtatgggatgggacacctgcttcagatccagctcggaatggaact
tccacggagtcggtgctaagtgacacacaggatcctgtgatcaagcacacatgtcccata
aatacagataaagcagacgctctagagcaatgttctccaagtaacgaggagaggagggaa
gaggaacctgaagagatggtgtctatacattaa

DBGET integrated database retrieval system