KEGG   Xenopus tropicalis (western clawed frog): 394491Help
Entry
394491            CDS       T01011                                 

Gene name
gamt, gamt-a, gamt-b
Definition
(RefSeq) guanidinoacetate N-methyltransferase
  KO
K00542  guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00260  Glycine, serine and threonine metabolism
xtr00330  Arginine and proline metabolism
xtr01100  Metabolic pathways
Module
xtr_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    394491 (gamt)
   00330 Arginine and proline metabolism
    394491 (gamt)
Enzymes [BR:xtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.2  guanidinoacetate N-methyltransferase
     394491 (gamt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 RrnaAD
Motif
Other DBs
NCBI-GeneID: 394491
NCBI-ProteinID: NP_988896
Xenbase: XB-GENE-947462
UniProt: Q6PBF6
Position
1
AA seq 232 aa AA seqDB search
MSERIFIEGESCKSAWHNATAGYDDTDTHLEILGKPVMERWETPYMHSLASVAASKGGRV
LEIGFGMAIAATKLEEYNIEEHWIIECNDGVFKRLQEWATKQPHKIVPLKGLWEDVVPTL
PDGHFDGILYDTYPLSEETWHTHQFNFIKGHAYRLLKPGGVLTYCNLTSWGELLKAKYND
IEKMFQETQIPQLVDAGFKSENISTTVMDLIPPEDCRYYSFKKMITPTIIKV
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacggatcttcatagagggcgagagctgcaagtccgcctggcacaatgcaact
gctgggtacgatgataccgacactcacctggagatcctgggtaaaccggtaatggagcga
tgggagactccatatatgcacagtctggcttcggtagcggccagcaagggtggccgtgtg
ctggagattggttttggcatggcaattgcagctactaagttggaagagtacaatatcgag
gaacactggataattgaatgcaatgatggtgtattcaagcggcttcaagaatgggccaca
aagcaaccacataagattgtgccattaaaagggctgtgggaggatgtagtgccaacatta
cccgatggacactttgatgggatcctttatgacacataccctctttccgaagaaacatgg
cacacgcaccagtttaactttatcaagggtcacgcttatcggctgcttaaacctggagga
gtcctcacctactgcaacctgacatcttggggtgaactactcaaggccaaatacaatgac
atagaaaaaatgttccaggagactcagattccacaactagtggatgctggttttaagtct
gagaatattagtactactgtaatggacctgataccccccgaggattgcagatactactcc
ttcaaaaaaatgatcacaccaaccattattaaggtctga

DBGET integrated database retrieval system