KEGG   Xenopus tropicalis (western clawed frog): 394517
Entry
394517            CDS       T01011                                 

Gene name
anxa2
Definition
(RefSeq) annexin A2
  KO
K17092  annexin A2
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    394517 (anxa2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xtr04131]
    394517 (anxa2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xtr04147]
    394517 (anxa2)
Membrane trafficking [BR:xtr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    394517 (anxa2)
Exosome [BR:xtr04147]
 Exosomal proteins
  Proteins found in most exosomes
   394517 (anxa2)
SSDB
Motif
Pfam: Annexin DUF2603
Other DBs
NCBI-GeneID: 394517
NCBI-ProteinID: NP_988921
Xenbase: XB-GENE-945315
UniProt: Q6P7M0
Position
3
AA seq 340 aa
MSLIHEILGKLSLEGNQSSTRQSTLGSVKASSNFDAERDAAAIETAIKTKGVDELTIINI
LTNRSNEQRQDIAFAYHRKTKKDLPSALKGALSGNLETFMLGLIKTPPQYDASELKASMK
GLGTDEDSLIEIICSRTNKELLNIQNAYRELFKTELEKDIVSDTSGDFRKLMVALAKGKR
QEECNVVDYEKIDQDARELYEAGVKRKGTDVNKWISIMTERSIPHLQKVFERYKSYSPYD
MEESIKKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGRGTKDKILIRIMISRSESD
MLKIRSEFKKKYGKSLHYFIGQDTKGDYQRALLNLCGGDD
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtcgcttattcacgagatcctgggcaagctgtccttggaaggaaatcaatcaagcaca
agacagtcgacattaggttcagtcaaagcaagctcaaactttgatgcagaaagggatgca
gcagccatcgaaactgccattaagactaaaggtgtggatgagttgacaatcatcaacatt
ctaacaaaccgcagtaatgaacagagacaagacatagcatttgcctaccacaggaaaaca
aagaaggacctgccatctgcattaaagggagctctctctggcaatctggaaacttttatg
ttggggctaattaagactccacctcagtatgatgcttcagaactgaaggcttcaatgaag
gggctgggcaccgatgaagatagcttaattgagatcatctgctcccggaccaataaagag
ttgctgaatattcagaatgcatacagagaattattcaagacagaactggaaaaagacatt
gtgtccgacacctctggtgatttccgcaaattaatggtggctcttgctaagggaaaacgc
caggaagaatgtaatgtggtagattatgagaagattgaccaagatgccagggagctgtat
gaagctggagtgaagaggaaaggaacagatgtgaacaaatggatctcaataatgacagaa
agaagcatcccccaccttcagaaagtatttgaaagatacaagagctacagcccatacgac
atggaagagagcattaagaaagaagtgaaaggagatctggagaatgcctttttgaatcta
gttcagtgcatccagaacaaacccctgtattttgcagacagattgtatgattcaatgaag
ggcagaggcaccaaagacaaaatcttgatccgaattatgatttcacgaagtgaatcggac
atgctgaaaatcagatcagagtttaagaagaaatatggcaaatcgttacattacttcatt
gggcaagacacaaaaggtgattaccagcgtgccctccttaacctctgtggaggagatgac
taa

DBGET integrated database retrieval system