KEGG   Xenopus tropicalis (western clawed frog): 394553
Entry
394553            CDS       T01011                                 

Gene name
ube2m
Definition
(RefSeq) NEDD8-conjugating enzyme Ubc12
  KO
K10579  ubiquitin-conjugating enzyme E2 M [EC:2.3.2.34]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    394553 (ube2m)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:xtr04121]
    394553 (ube2m)
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.34  E2 NEDD8-conjugating enzyme
     394553 (ube2m)
Ubiquitin system [BR:xtr04121]
 Ubiquitin-conjugating enzymes (E2)
  UBL-conjugating enzymes
   394553 (ube2m)
Motif
Pfam: UQ_con CblD
Other DBs
NCBI-GeneID: 394553
NCBI-ProteinID: NP_988956
Xenbase: XB-GENE-1005525
UniProt: Q6P8D9
Position
7
AA seq 183 aa
MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCEIEFSDHDDLLNF
KLVICPDEGFYKGGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWK
PVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFER
CLK
NT seq 552 nt   +upstreamnt  +downstreamnt
atgatcaaactcttctccctcaagcagcagaagaaggaggaggaatctgcagggggaact
aaaggcagcagtaaaaaggcctcagccgcacaacttcgcattcagaaagatattaacgaa
ctgaatttgccgaagacatgtgaaatagagttctcagaccacgatgatctcttaaatttc
aaattagtcatctgccctgatgagggtttctacaagggtggaaaatttgtgttcagtttt
aaggtcggacagggctacccacatgaccctccaaaggtgaaatgtgaaaccatggtatat
catccaaatatagacctagagggcaatgtctgcttaaatattctaagagaggactggaag
cctgtactcacaataaattcaataatttatggcctgcagtatcttttcttggagccaaac
cctgaagacccattaaataaagaagctgctgaggttcttcagaacaacagacgcctgttt
gaacagaatgtgcagcgatctatgcggggtggttacataggatccacctactttgagcgc
tgcttgaaatag

DBGET integrated database retrieval system