KEGG   Xenopus tropicalis (western clawed frog): 394581
Entry
394581            CDS       T01011                                 

Gene name
ppid
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase D
  KO
K05864  peptidyl-prolyl isomerase D [EC:5.2.1.8]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04217  Necroptosis
xtr04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    394581 (ppid)
   04218 Cellular senescence
    394581 (ppid)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:xtr03110]
    394581 (ppid)
Enzymes [BR:xtr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     394581 (ppid)
Chaperones and folding catalysts [BR:xtr03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    394581 (ppid)
SSDB
Motif
Pfam: Pro_isomerase TPR_1 TPR_2 TPR_11 TPR_9 TPR_8 TPR_12 TPR_19 TPR_14 NARP1 TPR_16 DUF627 TPR_6 Thioredoxin_3 ANAPC3
Other DBs
NCBI-GeneID: 394581
NCBI-ProteinID: NP_988984
Xenbase: XB-GENE-855598
UniProt: F6RM88
Position
1
AA seq 370 aa
MSNPSPVAKPSNPSNPKVFLDVEIGGERVGRIVLELFADVVPKTAENFRALSTGEKGIGQ
STGKPLHFKGCPFHRIIKKFMIQCGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSM
ANAGPNTNGSQFFITTVPTAHLDGKHVVFGQVLKGYGIVKMLENVEVKDEKPAKMCVIAE
CGELNDRDEWISSPADGSGDTHPDFPEDSDVELNDVERITSIAENVKNIGNNFFKSQNWE
MATKKYNKALRYVESCKDVTGDDNISKLNPIAVSCNLNIAACKLKVSDFRAAIDSCNEAL
EIDPSHTKALYRRAQGWQGLKDYEQALEDLKKAHELSPDDKAVSGEILRVKQRIKEQKEK
EKAVYAKMFA
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgtctaacccaagcccagtggccaagccgtccaacccctccaacccaaaggtgttcctg
gatgtggagattggaggagagcgcgtgggtcggattgttttggaattgtttgctgatgtt
gtgcccaaaactgcagaaaatttccgtgccctctctactggggaaaagggcattggccaa
tcaaccggaaagcctcttcattttaaaggatgcccttttcacagaattattaagaaattc
atgatccagtgtggagacttctcaaaccaaaatggaactggaggcgaaagtatatatggg
gagaaatttgaggatgaaaatttccattacaagcatgacaaagaagggttactcagcatg
gctaatgctggtccaaatactaatggctcacagttctttatcactactgtacctacagct
catttagatggaaagcatgtggttttcggccaagtgcttaaaggatatggcattgtcaaa
atgttggaaaacgttgaagtaaaggatgagaagcctgcaaagatgtgtgtgatagcagag
tgtggggaactgaatgacagggatgaatggatatcttctccagcagatggttctggcgac
acccaccctgactttccagaggactcggatgtagaattaaatgatgttgaaagaattacc
agtatagcggaaaatgtgaagaatataggaaataatttcttcaaatctcagaactgggaa
atggcaacaaagaagtataacaaagctctaagatatgtagaaagctgcaaagatgtcaca
ggagatgacaacatatcaaagttaaacccgattgctgtcagctgtaacttgaatattgct
gcctgcaaactcaaagtatctgactttagagcagccattgatagctgcaatgaggccctg
gaaattgatccatctcacaccaaagcactttacaggagggctcagggttggcaaggatta
aaggactatgaacaagcactggaggatcttaaaaaggctcatgaattatcaccagatgat
aaagctgtcagtggtgaaattctgcgagtcaagcagaggattaaagagcaaaaagaaaag
gagaaggccgtatatgccaagatgtttgcctaa

DBGET integrated database retrieval system