KEGG   Xenopus tropicalis (western clawed frog): 394685
Entry
394685            CDS       T01011                                 

Gene name
serp1
Definition
(RefSeq) stress-associated endoplasmic reticulum protein 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
SSDB
Motif
Pfam: RAMP4 DUF1206 DUF4079
Other DBs
NCBI-GeneID: 394685
NCBI-ProteinID: NP_989085
Xenbase: XB-GENE-1004958
UniProt: Q6P650
Position
5
AA seq 66 aa
MVAKQRIRMANEKHSKNITQRGNVAKSSRNVTEEKSAVGPWLLALFIFVVCGSAIFQIIQ
SIRMGM
NT seq 201 nt   +upstreamnt  +downstreamnt
atggtagccaaacagagaatccgcatggccaatgagaagcacagcaagaacatcacacag
agaggcaacgtggccaagtcatcgagaaatgtgacggaggagaaatctgcagtgggacca
tggttactggcgctatttatcttcgtggtctgtggatccgctattttccagattattcag
agcatcaggatgggcatgtaa

DBGET integrated database retrieval system