KEGG   Xenopus tropicalis (western clawed frog): 394780
Entry
394780            CDS       T01011                                 

Gene name
ywhaz
Definition
(RefSeq) 14-3-3 protein zeta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04110  Cell cycle
xtr04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    394780 (ywhaz)
   04114 Oocyte meiosis
    394780 (ywhaz)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:xtr03400]
    394780 (ywhaz)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xtr04147]
    394780 (ywhaz)
DNA repair and recombination proteins [BR:xtr03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    394780 (ywhaz)
Exosome [BR:xtr04147]
 Exosomal proteins
  Proteins found in most exosomes
   394780 (ywhaz)
SSDB
Motif
Pfam: 14-3-3 AAA_15 Peptidase_C98 CSN7a_helixI
Other DBs
NCBI-GeneID: 394780
NCBI-ProteinID: NP_989173
Xenbase: XB-GENE-970616
UniProt: Q6P4Z5
Position
6
AA seq 245 aa
MDKNELVQKAKLAEQAERYDDMAACMKRVTEEGGELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQEMSREYREKIEAELREICNDVLNLLDKFLIANASQPESKVFYLK
MKGDYYRYLAEVASGDAKADIVAQSQKAYQDAFDISKTEMQPTHPIRLGLALNFSVFYYE
ILNCPEKACSLAKAAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEQG
EGGEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggataaaaacgaactggttcagaaggccaagttggctgaacaggcagagcggtacgat
gacatggctgcttgtatgaagagagttaccgaggagggaggggaactgtccaatgaagaa
aggaaccttctctcagtggcctacaaaaatgtagtaggtgcgcgtcggtcgtcctggcgg
gtggtgtctagtattgagcagaagacggaaggagctgaaaagaaacaggagatgtcacga
gaatacagggagaagattgaggctgaattgcgagaaatctgcaatgacgttctgaatctt
ctggacaaattcttgattgccaacgcatcacaaccggaaagcaaagttttctatttgaaa
atgaagggtgactattatcgttacttggctgaagtagcttctggcgacgcaaaggcagat
atcgtggcccagtcacagaaggcatatcaagatgcttttgacatcagcaaaactgaaatg
caaccaacacatcctatccgattgggtctggccctgaacttctctgtgttctattatgag
atcctcaattgtccagagaaagcgtgttctcttgcaaaggccgcttttgatgaagccatt
gctgagcttgacactttgagcgaagagtcctacaaagacagcacattaataatgcagtta
ctgagagacaacttaacattgtggacatcagacacccaaggggatgaagctgaacaagga
gaaggaggggagaattaa

DBGET integrated database retrieval system