KEGG   Xenopus tropicalis (western clawed frog): 394828
Entry
394828            CDS       T01011                                 

Gene name
col2a1
Definition
(RefSeq) collagen alpha-1(II) chain precursor
  KO
K19719  collagen, type II, alpha
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04510  Focal adhesion
xtr04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    394828 (col2a1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    394828 (col2a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:xtr00536]
    394828 (col2a1)
Glycosaminoglycan binding proteins [BR:xtr00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   394828 (col2a1)
SSDB
Motif
Pfam: Collagen COLFI VWC TILa
Other DBs
NCBI-GeneID: 394828
NCBI-ProteinID: NP_989220
Xenbase: XB-GENE-6258353
UniProt: Q6P4Z2
Position
2
AA seq 1492 aa
MFSFVDSRTLVLFAATQVILLAVVRCQDEEDVLATGSCVQHGQRYSDKDVWKPEPCQICV
CDTGNVLCDEIICEDPKDCPNAEIPFGECCPICPTEQSSTSSGQGVLKGQKGEPGDIKDV
VGPKGPPGPQGPSGEQGPRGDRGDKGEKGAPGPRGRDGEPGTPGNPGPVGPPGPPGPPGL
GGNFAAQMTGGFDEKAGGAQMGVMQGPMGPMGPRGPPGPTGAPGPQGFQGNPGEPGEPGA
GGPMGPRGPPGPAGKPGDDGEAGKPGKSGERGPPGPQGARGFPGTPGLPGVKGHRGYPGL
DGSKGEAGAAGAKGEGGATGEAGSPGPMGPRGLPGERGRPGASGAAGARGNDGLPGPAGP
PGPVGPAGAPGFPGAPGSKGEAGPTGARGPEGAQGPRGESGTPGSPGPAGASGNPGTDGI
PGAKGSSGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGDPGVAGFKGEHGPKGEIGS
AGPQGAPGPAGEEGKRGARGEPGAAGPLGPPGERGAPGNRGFPGQDGLAGPKGAPGERGV
PGLGGPKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGASGEDGRPGPPGPQGA
RGQPGVMGFPGPKGANGEPGKAGEKGLLGAPGLRGLPGKDGETGAQGPNGPAGPAGERGE
QGPPGPSGFQGLPGPPGSPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSSGPQGL
QGPRGLPGTPGTDGPKGATGPSGPNGAQGPPGLQGMPGERGAAGISGPKGDRGDTGEKGP
EGAPGKDGSRGLTGPIGPPGPSGPNGEKGESGPSGPAGIVGARGAPGDRGETGPPGPAGF
AGPPGADGQAGLKGDQGESGQKGDAGAPGPQGPSGAPGPQGPTGVNGPKGARGAQGPPGA
TGFPGAAGRVGPPGPNGNPGPSGAPGSAGKEGPKGARGDAGPTGRAGDPGLQGPAGVPGE
KGESGEDGPSGPDGPPGPQGLSGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGGPGSAGD
RGPPGPVGPPGLTGPAGEPGREGNAGSDGPPGRDGATGIKGDRGETGPLGAPGAPGAPGA
PGPVGPTGKQGDRGESGPQGPLGPSGPAGARGLPGPQGPRGDKGEAGEAGERGQKGHRGF
TGLQGLPGPPGTAGDQGASGPAGPGGPRGPPGPVGPSGKDGSNGLPGPIGPPGPRGRGGE
TGPAGPPGQPGPPGPPGPPGPGIDMSAFAGLSQPEKGPDPMRYMRADQASSSVPQRDVDV
EATLKSLNNQIESIRSPDGTKKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTVDAIKVFC
NMETGETCVYPNPSKIPKKNWWSAKGKEKKHIWFGETINGGFQFSYGDDSSAPNTANIQM
TFLRLLSTDATQNITYHCKNSIAFMDEASGNLKKAVLLQGSNDVEIRAEGNSRFTYNALE
DGCKKHTGKWSKTVIEYRTQKTSRLPIVDIAPMDIGGADQEFGVDIGPVCFL
NT seq 4479 nt   +upstreamnt  +downstreamnt
atgtttagctttgtggattcaaggactctagtgctgttcgcagccacacaagtcatttta
ttagcggttgtacgatgccaagatgaagaagatgtcctggccacaggcagctgcgtgcag
catgggcagaggtatagtgataaagatgtgtggaaaccagagccctgccaaatctgtgtc
tgtgacactgggaatgttctctgcgatgagataatctgcgaagatcccaaagattgcccc
aatgctgagatccccttcggagagtgctgccccatctgcccaactgagcaatcttctacc
tccagtgggcaaggagtactcaagggccagaaaggtgaacccggtgatattaaagatgtt
gtaggaccaaaaggaccacctggaccacagggaccttctggtgaacaaggacctagagga
gatcgtggagacaagggcgagaaaggtgctcctggaccccgtggaagagatggcgaaccc
ggtactcctgggaacccaggacctgttggaccccctggacctcctggaccccctggcctt
ggcggaaactttgctgctcaaatgacaggaggatttgatgaaaaagctggtggtgcacaa
atgggagttatgcaaggaccaatgggccctatgggaccaagaggacctcccggcccaaca
ggagctcctggacctcaaggtttccaaggcaatcccggtgaacctggtgaacctggcgct
ggtggtccaatgggtccccgtggtcctcctggccctgctggaaagcctggtgatgatggt
gaagctggcaaacctggcaaatctggtgagcgtggacccccaggaccacagggagctaga
ggtttccctggaaccccaggacttccaggagtaaaaggacacaggggttacccaggtctt
gatgggtcaaagggtgaagctggtgctgctggtgccaagggagaaggtggtgctactggt
gaagctggatctcctggtccaatgggtccccgtggtcttccaggtgagagaggacgccct
ggagcttctggtgctgctggtgctcgtggtaatgatggtcttcctggccctgctggtccc
ccaggacctgttggccctgctggtgctcccggtttccctggtgctcctggttcaaagggt
gaagctggcccaactggtgctcgtggacctgagggtgctcaaggacccagaggagaatct
ggtacccctggatctcctggacctgctggagcttctggtaaccctggtactgatggtatt
cctggcgccaaaggttcatctggtgctcctggtattgctggtgcccctggtttccctgga
ccacgtggtcctccaggacctcagggagctactggtcctcttggtcccaaaggccagact
ggtgaccccggtgttgcaggtttcaagggtgaacatggtcccaaaggtgaaatcgggtct
gcaggtcctcagggtgctcctggcccagctggtgaagaaggcaagagaggagcccgtggt
gaacctggtgctgctggaccccttggtcctcctggagagagaggtgctcctggtaatcgt
ggtttccctggtcaagatggtcttgctggtcctaagggtgctcctggtgaacgtggtgtt
ccaggtcttggtggaccaaagggtgctaatggtgatcctggccgtcctggcgaacctggt
ctccctggtgctaggggtcttactggccgtcctggtgatgctggtcctcagggaaaagtt
gggccctctggtgcttctggtgaagatggtcgtcctggacctcctgggccacaaggtgct
cgtggtcagcctggtgttatgggtttccctgggcctaaaggtgccaatggcgaacctggc
aaagctggtgagaaaggactgcttggtgctcctggtctgaggggtctgcctggaaaagat
ggtgaaactggtgctcaaggtcccaatggtccagctggacctgctggtgaaagaggtgaa
caaggacctcctggcccatctggcttccagggacttcctggacctcccggttctcccgga
gaaggtggcaaaccaggtgatcagggtgttcccggtgaagcaggtgcccctggtcttgtt
ggcccaagaggtgagcgtggtttcccaggtgaacgtggttcttcaggtcctcaaggtctt
cagggtcctcgtggtcttcctggaactcctggtactgatggtcccaagggtgcaactggt
ccatctggtcccaatggtgcccaaggtcctcctggtcttcaaggtatgcctggtgagaga
ggagctgctggtatatctggacccaagggtgatagaggtgatactggtgagaaaggccca
gagggtgctcctggtaaagatggttcaagaggtttgactggtccaattggcccccctggt
ccatctggtcctaatggtgagaagggagaatctggtccttccggtccagctggtattgtt
ggtgcccgtggtgcccctggtgatcgtggtgagactggccctccaggtcctgctggcttt
gctggtcctcctggtgctgatggtcaagctggtcttaagggtgatcaaggtgaatctggc
cagaagggtgatgctggtgctcctggtccccagggtccatctggtgctcctggcccacag
ggcccaactggtgttaatggtcctaagggagctcgcggtgctcaaggtcctcctggtgct
actggattccctggtgctgctggaagagttggtccccctggtcccaatggtaaccctgga
ccttcaggtgctcctggatctgctggtaaagaagggccaaagggtgcacgtggtgatgct
ggtcctactggtcgtgctggtgatccaggtcttcaaggtcctgctggtgttcctggagag
aagggagagtctggtgaagatggtccttctggtccagatggtcccccaggtcctcaaggt
ttgtctggacagcgtggtattgttggtctgccaggtcagcgtggtgaaagaggattccct
ggacttcctggtccatctggtgaacctggaaaacaaggaggccctggatctgctggagac
cgtggaccccctggccctgttggcccacctggtttgactggacctgctggagagcctgga
cgtgaaggtaacgctggatctgatggcccacctggtcgtgatggtgctactggaattaag
ggtgatcgtggtgagactggtcctcttggtgctcctggtgctcccggtgcccctggtgct
cctggacctgttggcccaactggaaaacaaggagacagaggagaatctggaccccaaggt
ccacttggtccatctggtcctgctggtgctcgtggcttgcctggtcctcaaggtccacgt
ggtgataagggtgaagctggtgaggcaggagagagaggacagaaaggtcacagaggattc
actggtcttcagggtctgccaggtcccccaggtactgctggtgaccaaggtgcttctggt
cctgccggtcctggtggtcctagaggtccccctggccctgttggtccttctggcaaagat
ggctctaatggtcttcctggtccaattggtccacctggtccacgcggtcgcggtggtgaa
actggtcctgctggtccacctggtcaacctggcccacctggtccccctggtcctcctggc
cctggaattgacatgtctgctttcgccggcctatctcaacctgaaaaaggacccgaccca
atgcgttacatgcgtgctgaccaagcctccagctctgtccctcagcgtgatgttgatgtt
gaagccactttgaaatcccttaataaccagatcgaaagcatccgcagcccagatggtacc
aagaagaacccagcccgcacatgccgtgacctgaaactctgccatcctgaatggaagagc
ggtgactattggatcgatcccaaccagggctgcactgtagatgctatcaaagtcttctgc
aacatggagactggagagacctgtgtataccccaacccatcaaagatccccaagaagaac
tggtggtccgccaagggcaaggaaaagaaacacatttggtttggagagacaatcaatggt
ggcttccaatttagctatggagatgacagctcagcacccaacactgccaacattcagatg
accttcctgcgtctgctctccactgatgcaacccagaacatcacctatcactgcaagaac
agcattgcatttatggatgaagcttcaggcaaccttaagaaggctgttctactccaagga
tccaatgatgtagaaatcagagctgagggcaacagtagattcacatacaatgccttggaa
gatggctgcaagaaacacactggcaaatggagcaagacagtaattgaatacaggacacag
aaaacatctcgcctgcccatcgtagacattgcacctatggatattggtggcgctgatcag
gaatttggtgttgacattggcccagtctgcttcttgtaa

DBGET integrated database retrieval system