KEGG   Xenopus tropicalis (western clawed frog): 394849Help
Entry
394849            CDS       T01011                                 

Gene name
b3gnt5, BGnT-5, Beta3Gn-T5, b3gn-t5, b3gnt5-a, b3gnt5-b
Definition
(RefSeq) UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5
  KO
K03766  beta-1,3-N-acetylglucosaminyltransferase 5 [EC:2.4.1.206]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00601  Glycosphingolipid biosynthesis - lacto and neolacto series
xtr01100  Metabolic pathways
Module
xtr_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
xtr_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    394849 (b3gnt5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:xtr01003]
    394849 (b3gnt5)
Enzymes [BR:xtr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.206  lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase
     394849 (b3gnt5)
Glycosyltransferases [BR:xtr01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   394849 (b3gnt5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T Fringe
Motif
Other DBs
NCBI-GeneID: 394849
NCBI-ProteinID: NP_989240
Xenbase: XB-GENE-955708
UniProt: Q6P3P5
Position
5
AA seq 377 aa AA seqDB search
MLISARRLRRCQFFQLLTSCFVLSLMALLVQEDNSLINHVKSYSYRYLINSYDFVNDSLS
VPRDRPDGAPSYRYLINNRDKCQNEDVLLLLFVKTSPENRRRRNAIRKTWGNEDYIRSQY
AANIKVVFALGIEADPVKSHQTQKDLVIENKRFNDLIQQDFKDTFHNLTLKLLLQFGWVN
SYCPSAKFIMSADDDIFVHTPNLVSYLKSLPIETQDFWIGRVHRGSPPIRSKTSKYYVPY
EMYPWSSYPDYTAGAAYVVSKDVAAKVYEASQTLNTSLYIDDVFMGICANKMGVVPQYHV
YFAGEGKAPYHPCIYNKMITSHGHLDDLDYLWRQATDPNVKSLSAGVLGGAYCKLVNIML
LCKLSYVDTYPCSAAWS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcttattagtgctaggaggctaagaagatgccagttctttcaattactcacttcatgt
tttgttttatcattaatggctttgttggttcaagaagacaattccttgatcaaccacgta
aagtcgtattcctacagatacctcataaatagctatgactttgtcaatgatagcctgtct
gttcctcgggacagacccgatggggcacccagctacagatatctgatcaataaccgagac
aaatgtcaaaacgaggatgtccttctattactgtttgtaaagacatctcctgaaaacaga
aggcgccgcaatgcaattcgaaagacttggggcaacgaggattacattcgttctcagtat
gctgccaacattaaagttgtgtttgcccttggtattgaagcagatccagtaaaaagtcat
caaactcaaaaagatcttgtcattgaaaacaaaagattcaacgatttaatacagcaagac
ttcaaggacacttttcacaacctaactcttaagttgcttttgcagtttgggtgggtaaat
tcatactgtcctagtgctaaattcattatgtcagccgatgatgatatctttgtccacaca
cctaacttggtttcctaccttaaaagcttgcctatcgaaacacaggatttctggattggt
agagtccatcgtggatcacctccaataagaagcaaaaccagcaagtattatgtgccttac
gaaatgtatccctggtcatcttatcccgactacactgcaggggctgcttatgttgtttct
aaagatgtagctgcaaaagtatacgaagcgtcacagacattaaataccagtttatacata
gatgatgttttcatgggaatctgtgccaacaaaatgggagttgtgcctcaatatcacgtt
tatttcgctggagaaggaaaagccccataccatccttgtatttacaacaaaatgattact
tcccatggacatttagatgaccttgactatttatggaggcaagctacagaccctaatgta
aaatctcttagtgctggagttttgggaggtgcatactgtaagttagtaaacatcatgctt
ctctgtaaacttagctatgtggatacatacccctgttcagccgcatggtcctag

DBGET integrated database retrieval system