KEGG   Xenopus tropicalis (western clawed frog): 394855
Entry
394855            CDS       T01011                                 

Gene name
kif22
Definition
(RefSeq) kinesin-like protein KIF22
  KO
K10403  kinesin family member 22
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    394855 (kif22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:xtr04812]
    394855 (kif22)
Cytoskeleton proteins [BR:xtr04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     394855 (kif22)
SSDB
Motif
Pfam: Kinesin Microtub_bd HHH_3 HHH_6 UPF0184
Other DBs
NCBI-GeneID: 394855
NCBI-ProteinID: NP_989245
Xenbase: XB-GENE-979888
UniProt: Q6P3R1
AA seq 639 aa
MAKRVSILDQHKKPSSARVRVAVRLRPYMEKEDEKAPAACVRGLDSQSLEIVNWRNQLET
MQYQFDAFYGDSATQREIYMGSVCHILPHLLIGQNASVFAYGPTGAGKTHTMLGNPSQPG
VIPRAVRDLLQMTRTAAGGPENENWTYTITMSYVEIYQEKVMDLLEPKNKDLPIREDKDH
NILIPGVTQKTINSFGDFDEHFIPASQNRTVASTKLNDRSSRSHAVLLIKVQKSQQVSPF
RQLTGKLYLIDLAGSEDNRRTGNQGIRLKESGAINSSLFTLSKVVDALNQGLPRIPYRDS
KLTRLLQDSLGGTAHSVMIANIAPEQKYYFDTLTALNFAAKSKQIINKPFSQETTQSIAA
LPAMKRPREEAETAAGSRQRKKSKTDSTESSPNTSMDAASKRKLNLAALDPAVVERLLKL
DKILTEKGMKEAQLLSTPKRERMALLKKWEESQMEIERLKEKQKELEQKAIEAEARLEKS
TNSDCNLSDSSVSECTFRAPLRGRNTSTAKAKKVLRVLPMQGNSQLQSTIEEGIPVFEKK
KKKPVSCDGRENQPTWEVNVRTDLLESGRERILKLLNTGSVKELKSLQKIGDKKAKLIIG
WREVNGPFKNVEDLASLEGISAKQVTSFIKANILSIIAS
NT seq 1920 nt   +upstreamnt  +downstreamnt
atggccaagcgggtgagcattctggatcagcacaagaagccgtcctcggcccgggtgcgt
gttgccgtcagactgaggccctacatggagaaagaggatgagaaagcgcccgccgcgtgt
gtccggggtctggactcgcagtcgctggagattgtcaactggaggaatcagctagagacc
atgcagtaccagtttgatgccttttatggtgacagcgccactcagcgggagatctacatg
ggctctgtgtgccacatcctcccgcacttactgattggccagaatgccagtgtttttgct
tatgggcccacaggggcagggaaaactcacaccatgttggggaaccccagtcagcctggc
gtgatccctcgggcagtgagggacttgttgcaaatgacccggacagcagccggcggccct
gagaatgagaactggacttacaccataacaatgtcttatgtggagatctaccaggagaag
gtcatggatttgctggagcccaaaaacaaggacctccccatccgagaggacaaagaccat
aacatcctgatcccaggtgtcacccagaaaaccatcaactcctttggggattttgatgag
cattttatccctgccagccagaaccgcaccgtggcctcaacgaagctgaacgaccgctcc
agccgcagccatgctgtgctactgatcaaggtacagaagagtcagcaggtttcgccattc
aggcagctaactgggaagctctacctcatagacttggctgggtcggaagataaccggcgc
actggaaaccaaggaatccggctcaaggagagcggcgccatcaactcctccttattcacg
ctcagcaaagtggtcgatgctctgaaccaggggctgccccgaatcccttacagagacagc
aagctgacccgattgctgcaggattccctgggaggaaccgcccacagtgtcatgatcgcc
aacatcgccccagagcagaagtattacttcgacaccctgacagctctgaactttgctgcc
aaatccaagcagatcataaacaaacctttcagccaggaaaccacccagtccatagcagct
ctgccggccatgaagaggcctcgggaggaggcagaaaccgcagcaggttctcggcagaga
aagaaatccaaaacagactcgacagagtcatctcccaatacttcaatggacgcggcgtcc
aagcggaaactcaatttggcggcgcttgaccctgctgtggttgagaggctgctgaaactg
gataagatcctgacagagaaaggaatgaaggaggcccagctcttaagtacccctaagaga
gagagaatggctctgctgaagaaatgggaggagagtcagatggagatagagaggctaaag
gagaagcaaaaggagttggagcagaaagccattgaagcagaggctcgactggagaagtcc
actaactctgactgcaacctatcagactccagcgtcagtgaatgcaccttccgggccccc
ctcaggggtagaaacacatccacagcaaaggccaagaaggttctgcgtgtgctgcccatg
caggggaacagccagttacagagcaccatagaggagggcatcccagtctttgagaagaag
aagaagaaaccggtctcatgtgacgggcgggagaaccagcccacgtgggaagtgaatgtg
cggacagacctgctagagagcggcagggagagaatcctgaaactgctcaacaccggctcc
gtcaaggaactgaaatccctgcagaagatcggagacaagaaggccaagctgatcattggc
tggagagaggtcaatgggccctttaaaaatgtggaagacttggcatctttggaagggatc
tctgctaaacaagtaacatcctttataaaggcaaacatcctgagcatcattgccagctga

DBGET integrated database retrieval system