KEGG   Xenopus tropicalis (western clawed frog): 394902Help
Entry
394902            CDS       T01011                                 

Gene name
nop14, nol14
Definition
(RefSeq) NOP14 nucleolar protein
  KO
K14766  nucleolar protein 14
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:xtr03009]
    394902 (nop14)
Ribosome biogenesis [BR:xtr03009]
 Eukaryotic type
  90S particles
   U3 small nucleolar RNA-associated proteins
    394902 (nop14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop14
Motif
Other DBs
NCBI-GeneID: 394902
NCBI-ProteinID: XP_002939267
Xenbase: XB-GENE-992782
Position
1
AA seq 879 aa AA seqDB search
MGKSAGKKGKPPAAAAAARVIAQKARTEIRDNPFEVKINKQKFNVLGRKTGKHDVGLPGV
SKSKALKRRKDTILMEYQRRGKVSVFMDKRFGEYDTKLTPDEKMMKRFAMERKKNAERKT
LYNLNEEEELTHYGQSLANLEKLNDTVDSDSDSEERGALSAELTASHFGGGGGLLRKKAQ
SDQKDEEAEKPKSRKELIEELIIKSKQEKRERQSQKEKSLELTEKLDSDWKAIQGLLSHK
TPKSERKTEEEKPKPDEYDKIVRELGFEMKAQPTDRMKSEEELAKEEQERLQKLEAERLR
RMRGDKDQKSKRAKHISADDLMDGFILDNDDRVMLSYKDGAMNLPEDIELEDVGKDTIGD
EDEEGSGDEEEEEGSGDDEEGSSGEEEDVEGSEDDASDNYSDLESDAGSEEPGSDAENTK
MEEKEKKNKERKSGAKAAKSELPFTFAAPESYESFQSLLSGKPVEQQLVVLERIQKCNHP
SLAEGNKAKLEKLFGFLLDYITDLASMDSPDLKAIDKLVIPLYNLCQMFPEAAGTCVRNA
LDESARAIDKMVEAKGRAALQGIHVLVHLKITAILFPTSDFWHSVVTPAMILMSQLLTLC
PIYSLEDVAAGLFVCCMFLEYVSLSKKFIPELINYLLGVLHLAVPRKESLDYVLVPPFKP
HGKNSELLLVGNNEDIDTWVKKPLPITAINGLSESSELEISHFKLTCIATCLDLVRRCVD
IYGPLPAFREILNPITTLLSKHLPTRDYSLQIQELQADILRTIEKNNKKPYQPLVFEKQM
AVPMKMFTPKLMPVLEFGRKQGCNQQERERKKLIHKHKREFKGAVREIRRDNQFLARVKL
SETMERDAERKRKVKELFNSLSTQEGEWKALKKKKLKGR
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atggggaagagtgcggggaagaaggggaagcccccggcggcggcggcggcagcccgagtt
atagcccaaaaagcccgcacggagatcagggataaccccttcgaggtgaagatcaacaag
cagaagtttaatgtgctgggaaggaaaactgggaaacacgacgtgggactgcccggggtg
tccaagtccaaagccctcaaacggcgcaaggacactattctgatggaataccagcggcgc
gggaaagtcagtgtttttatggacaagcgctttggggaatatgacaccaaattaacccca
gatgaaaagatgatgaagcgatttgctatggaacggaagaaaaatgctgagaggaaaacc
ttatacaatctgaatgaagaggaggagctgacacactatgggcagtcgctggcaaatttg
gaaaaactgaatgacactgtagacagtgacagcgactcggaggaacgcggagctttgtca
gctgaactgactgcttcccattttggtggcggcggtggcctgcttaggaaaaaggcccag
tctgatcagaaggatgaggaggctgaaaaaccaaagagccgtaaggagctgattgaggaa
ctgatcattaaatccaaacaggagaagagagaaaggcagagccaaaaggagaagtccttg
gaactgaccgagaaactcgacagtgactggaaagccatacagggactcctgtcacacaaa
actccaaaatctgagagaaagacggaggaagaaaagccaaagccagatgaatacgataag
attgtccgggagctgggatttgagatgaaagctcagcccacagacaggatgaagtctgaa
gaagaactggctaaggaagagcaagagcggctgcagaaactggaggctgaaaggctcagg
cgaatgcgaggagataaagaccagaaatccaagagagccaagcacatctcagctgatgat
ttaatggatggattcatactggataacgatgaccgtgtgatgctttcctataaggatggt
gccatgaatcttcctgaggacatagagctggaggatgttggcaaagacaccattggtgat
gaggatgaggagggcagtggcgatgaggaggaagaggagggcagtggtgatgatgaagag
ggcagcagcggtgaagaggaagacgttgaaggaagcgaggatgatgcctcggacaattat
tctgacctagagtctgatgcaggtagtgaggaaccaggcagcgatgctgaaaatacaaag
atggaagaaaaagagaaaaagaacaaagagagaaaatctggtgcaaaggctgccaagtct
gagcttccctttacttttgctgctcctgagtcctatgaaagtttccagtctctcttgtct
gggaaacctgtggaacagcagctggttgttttggagaggatccagaagtgcaaccaccca
agcctggccgaaggaaacaaggctaagttagagaaactgtttgggttcctgctggactac
ataaccgatctggcaagcatggactcacctgatctgaaagcaatcgacaagctggtcatc
cccctgtacaatctgtgccagatgtttcctgaagccgcaggtacttgtgtcagaaacgcc
ctcgacgaatctgcgcgtgccattgacaaaatggtagaagccaaaggccgggctgccctc
caagggatacatgtgcttgtccacctcaaaattacagcaatcctattccccacgtctgat
ttctggcattctgtggtcaccccagccatgattctgatgagccagttactaacgttgtgc
ccaatctactcattggaagatgttgctgctggcctgtttgtgtgctgcatgtttctggag
tatgtttctctctccaaaaagtttatcccagagctgataaactacctactaggagtactt
catctagcggtgccaaggaaagagtcactagattatgtcctggttccgccctttaaacca
catgggaagaactctgagcttctactggttgggaacaatgaggacattgacacctgggtg
aagaagcccctcccaataactgcaatcaatgggctttctgaaagcagtgagctggaaatc
agtcacttcaagttgacgtgtatagcaacatgtctggatctagtaaggcggtgtgtggat
atttatgggcctttacctgctttccgagaaatcttgaatcctattacaactctcctcagt
aagcatttaccaaccagggactactccctgcaaattcaggaattgcaagcagatatattg
aggactattgagaagaataacaagaaaccgtaccaaccgctggtgtttgaaaagcagatg
gctgtgccaatgaaaatgttcacaccaaaattaatgccagtgcttgagtttggcagaaaa
cagggttgcaaccagcaagagcgcgaaagaaagaagctaattcacaagcacaagcgggaa
ttcaagggagctgtccgagaaattcgtagagacaaccagttcctggccagagtcaagttg
tccgagaccatggaaagggatgctgaaaggaagaggaaagtgaaagagcttttcaatagt
ctttcaactcaagagggtgaatggaaagcgctgaaaaagaagaagctgaaggggagatga

DBGET integrated database retrieval system