KEGG   Xenopus tropicalis (western clawed frog): 394964Help
Entry
394964            CDS       T01011                                 

Gene name
guk1, gmk
Definition
(RefSeq) guanylate kinase 1
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00230  Purine metabolism
xtr01100  Metabolic pathways
Module
xtr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    394964 (guk1)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     394964 (guk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 AAA_33 MMR_HSR1 ABC_tran RsgA_GTPase AAA_22 AAA_17 NACHT AAA_29 cobW RNA_helicase AAA_28 AAA_14 AAA_30 AAA AAA_24 dNK NTPase_1 Mg_chelatase Roc ATPase_2 Zeta_toxin DUF815 AAA_5 TsaE AAA_23
Motif
Other DBs
NCBI-GeneID: 394964
NCBI-ProteinID: NP_001034818
Xenbase: XB-GENE-979074
UniProt: Q28EB2
Position
6
AA seq 213 aa AA seqDB search
MISSWSKVFRVTAAGMAGPRPVVLSGPSGAGKSTLLKRLMNEYEGLFGFSVSHTTRKPRP
GEADGKDYHFVSLDDMKKGIERGEFIEHAVFSGNMYGTSTAAVQAVQARNQICILDIDMQ
GVKSIKKTSLNPIYISIHPPSVPILEKRLRDRNTESEESLQKRLNAAIADLEISKEPGLF
DAIIVNDDLEEAYAHLKGTLAQEIKQAQSSKNS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcagctggagtaaggtcttccgggtaacggctgcaggtatggctgggcccagg
ccagtggtgctgagcggcccctccggggcggggaaaagcaccctcctcaagcgactcatg
aacgaatatgaagggctgtttggcttttcagtttctcataccacgagaaagccccgccct
ggggaggctgatgggaaagattaccattttgtgagtctggacgacatgaagaagggaata
gagagaggggagtttatagaacatgcagtgttttctgggaacatgtacgggaccagtacc
gccgccgtgcaggccgtccaggccaggaaccagatctgtatactggatatcgacatgcag
ggagtgaagagcataaagaagaccagtctgaatcccatttacatctccattcacccaccg
tcagttccaatattagagaagcggttacgagacagaaacacagagtcggaggaaagttta
cagaaaagactgaacgcagcaatagccgacctggagatcagcaaagagcctggtctgttt
gatgccattattgtcaatgatgatttagaagaggcctacgctcatctgaagggaaccctg
gcacaagagatcaaacaagcccagagcagcaagaattcctga

DBGET integrated database retrieval system