KEGG   Xenopus tropicalis (western clawed frog): 394994
Entry
394994            CDS       T01011                                 

Gene name
sgta
Definition
(RefSeq) small glutamine-rich tetratricopeptide repeat-containing protein alpha
  KO
K16365  small glutamine-rich tetratricopeptide repeat-containing protein alpha
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xtr04147]
    394994 (sgta)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   394994 (sgta)
SSDB
Motif
Pfam: TPR_1 TPR_2 SGTA_dimer TPR_8 TPR_11 TPR_7 TPR_17 TPR_16 TPR_14 TPR_12 TPR_19 TPR_10 TPR_9 BTAD TOM20_plant NARP1 TPR_15 Fis1_TPR_C STI1
Other DBs
NCBI-GeneID: 394994
NCBI-ProteinID: NP_001032333
Xenbase: XB-GENE-962231
UniProt: Q28H19
Position
1
AA seq 314 aa
MADKKRLAFSIIRHLHDQLRNGGLSSDAQESLEVAIQCLETAFEVSIEDSNLAVPRSLQE
IFTEATCQDSPQVNSGLASPCDEDVAEAERLKTEGNEQMKLENFESAISYYSKALELNPT
NAVYYCNRAAAYSKLGNYAGAVRDCEEAITIDPNYSKAYGRMGLALSSLNKHAEAVGFYK
QALILDPDNETYKSNLKIAEQKMKELPSPMAAPGGFDLAGLLNNPGFMSMASNLMNNPQV
QQLMSGMISGGHTPMAGAGAAAAGNTPPNDLASLIQAGQQFAQQMQQQNPELIEQLRSQI
RSRPPSSSHDEQQE
NT seq 945 nt   +upstreamnt  +downstreamnt
atggctgacaaaaaacgcttagctttctccattattcggcatttacatgaccagttacgc
aatggtgggctttcctcagatgcacaggagagcctggaagttgctattcagtgcctggag
acagcctttgaggtttccattgaagacagtaacttagctgtaccaaggagtctccaagag
atatttacagaagccacatgtcaggactctccgcaagttaattctggcctggcctcccct
tgtgatgaggatgtagcagaagctgaaagattgaagacagaaggcaatgagcaaatgaaa
ttagaaaattttgaaagtgctatttcctactactcaaaagctcttgaactgaacccaaca
aatgctgtgtactactgcaacagggctgcagcttacagcaaactgggcaactatgctgga
gctgtgagggactgtgaagaggcaattacaattgaccctaactacagcaaagcttatggc
agaatgggactggcactttcaagcttgaataaacatgcagaagctgtaggtttttacaaa
caagccctgatactggatccagacaatgaaacctacaaatcaaacctaaagattgcagaa
cagaaaatgaaagagctgcccagcccaatggctgctcctggaggttttgatttggctggc
ttgctcaataacccaggctttatgagcatggcgtcaaatcttatgaataacccccaagtt
cagcaactaatgtcaggaatgatctctggtggccacacaccaatggctggggctggagct
gcagctgcaggaaacactcctccaaatgatttggccagtcttatacaagcaggacaacag
tttgctcagcagatgcaacagcagaatccagagctgatagaacaattgcgcagtcagatt
cgaagtcgacctccaagttcaagtcatgatgagcaacaagaatga

DBGET integrated database retrieval system