KEGG   Xenopus tropicalis (western clawed frog): 395037Help
Entry
395037            CDS       T01011                                 

Gene name
ppp3r1
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, alpha
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
xtr04020  Calcium signaling pathway
xtr04114  Oocyte meiosis
xtr04218  Cellular senescence
xtr04310  Wnt signaling pathway
xtr04370  VEGF signaling pathway
xtr04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    395037 (ppp3r1)
   04310 Wnt signaling pathway
    395037 (ppp3r1)
   04370 VEGF signaling pathway
    395037 (ppp3r1)
   04020 Calcium signaling pathway
    395037 (ppp3r1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    395037 (ppp3r1)
   04218 Cellular senescence
    395037 (ppp3r1)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    395037 (ppp3r1)
 Human Diseases
  Infectious diseases
   05163 Human cytomegalovirus infection
    395037 (ppp3r1)
Protein phosphatases and associated proteins [BR:xtr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     395037 (ppp3r1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 395037
NCBI-ProteinID: NP_989400
Xenbase: XB-GENE-948794
UniProt: Q6VN50
Position
5
AA seq 170 aa AA seqDB search
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaagcaagctatccgctggaaatgtgctcacatttcgatgctgatgagatc
aaaaggctagggaaaaggttcaagaaactggatttagacaactctggttccctgagtgtg
gaggagttcatgtcgttaccagagcttcaacagaaccctcttgtgcagcgagtaatagac
atattcgacacggatggaaacggagaagtagattttaaagagtttatcgaaggagtgtcc
cagttcagcgtcaaaggtgataaggagcagaaactgaggtttgcttttcgtatatatgat
atggacaaggatggctacatctccaatggtgagcttttccaggtactgaagatgatggtg
ggaaacaatctcaaagacactcagttacagcaaatagtagacaaaacgattatcaatgca
gataaagatggggatggaaggatatcctttgaagaattctgtgctgtcgtaggaggctta
gatatccacaaaaagatggtggtggatgtgtga

DBGET integrated database retrieval system