KEGG   Xenopus tropicalis (western clawed frog): 407869Help
Entry
407869            CDS       T01011                                 

Gene name
rela, Xrel1, nfkb3, xrela
Definition
(RefSeq) v-rel avian reticuloendotheliosis viral oncogene homolog A
  KO
K04735  transcription factor p65
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
xtr04137  Mitophagy - animal
xtr04210  Apoptosis
xtr04218  Cellular senescence
xtr04620  Toll-like receptor signaling pathway
xtr04621  NOD-like receptor signaling pathway
xtr04622  RIG-I-like receptor signaling pathway
xtr04623  Cytosolic DNA-sensing pathway
xtr04625  C-type lectin receptor signaling pathway
xtr04920  Adipocytokine signaling pathway
xtr04933  AGE-RAGE signaling pathway in diabetic complications
xtr05132  Salmonella infection
xtr05168  Herpes simplex infection
Module
xtr_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    407869 (rela)
 Cellular Processes
  Transport and catabolism
   04137 Mitophagy - animal
    407869 (rela)
  Cell growth and death
   04210 Apoptosis
    407869 (rela)
   04218 Cellular senescence
    407869 (rela)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    407869 (rela)
   04621 NOD-like receptor signaling pathway
    407869 (rela)
   04622 RIG-I-like receptor signaling pathway
    407869 (rela)
   04623 Cytosolic DNA-sensing pathway
    407869 (rela)
   04625 C-type lectin receptor signaling pathway
    407869 (rela)
  Endocrine system
   04920 Adipocytokine signaling pathway
    407869 (rela)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    407869 (rela)
  Infectious diseases
   05132 Salmonella infection
    407869 (rela)
   05168 Herpes simplex infection
    407869 (rela)
   05163 Human cytomegalovirus infection
    407869 (rela)
Transcription factors [BR:xtr03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    407869 (rela)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_DNA_bind RHD_dimer
Motif
Other DBs
NCBI-GeneID: 407869
NCBI-ProteinID: NP_001001211
Xenbase: XB-GENE-946506
UniProt: Q6NVN7
Position
4
AA seq 533 aa AA seqDB search
MEGFLPSLWTDMVSSTVMPSSHPHVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTK
THPTIKINHYQGSARIRISLVTKDSPHKPHPHELVGKDCKDGYYEAELSPDRSIHSFQNL
GIQCVKKREVEDAIAHRIRTNNNPFNVPPEELKSDYDLNTVCLCFQVFIPDRAAGQVVPL
PFVVSQPIYDNRAPNTAELKICRVNRNSGSCMGGDEIFLLCDKVQKDIEVLFVLGNWEAR
GIFSQADVHRQVAIVFRTPAFHDTKIRQSVKVQMQLRRPSDKEVSEPMEFQYLPDEVDPH
HIDEKRKRTLDSFKHYVKNPFAGGETRTPRRIAVPNRIVPTKSEPITASIRPSPSVPNPM
VPSLSFSMPVLKVDSVTSASTRLSTVNISDFSNLGFSSQPPPQSDPDRIESFLNYPSFSG
DANLDLVEMLPNDTESRCTSLSSIDNSDFSQLLSESQTSGTLSAGLQEPGTSQGTLMSYP
DSIARLMSNRPIEDDGEERIDSVLMNGVFDMQQGVESITSLLDLDLSSFMNIK
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggagggatttcttccttccctatggacagacatggtttcaagcacagtcatgccttcc
tcccacccacatgtggaaattatagaacagccaaaacagcgagggatgcgatttcgttac
aagtgtgaaggccgctctgctggaagcattccaggtgaacgaagcactgacacaacaaaa
actcatcccactattaagataaaccattaccagggctcagcgcgtattcgaatatcccta
gttactaaggattctccacacaaacctcaccctcatgagttggtaggaaaggactgtaag
gatggatattatgaagctgaactttccccagatcgtagtattcacagcttccagaacctt
ggcattcagtgtgtgaaaaagagagaggtggaggatgccatcgcccatcgtattcggaca
aataataacccttttaatgtgcctcctgaggagctgaagagtgattacgacctcaacact
gtttgcctgtgcttccaagtcttcattcctgatcgagctgctggtcaggtggttccttta
ccatttgtggtatcccagcccatctatgacaacagagcccctaatactgctgaactgaag
atatgccgagtgaacagaaattctgggagttgcatgggaggagatgagatcttcttactt
tgtgataaagtacaaaaagatatcgaggtgctattcgttttgggcaactgggaagctcga
ggcatattttcacaagcagatgttcaccgccaggtagccattgtcttcagaacacctgct
ttccatgacacaaaaatacgtcagtctgtcaaagtgcaaatgcagctgaggcggccatca
gacaaggaagtcagtgagcctatggagtttcagtatcttccagatgaagttgacccccac
catattgatgaaaaacggaaaaggacccttgacagtttcaagcattatgtgaagaatcct
tttgcaggaggagagacacgaaccccacgcagaattgctgtgccaaatcgtatagtgcca
acaaagtcagagcctataacagcatccattagacccagcccttcagttccaaatccaatg
gtgccttctctttcattttccatgccagtattgaaggttgacagtgtgacttcagcttcg
actcgtctatccaccgttaacatcagcgacttcagcaatttaggattttcatcacagcct
ccccctcagtctgatcctgaccgcatagaatcctttttaaactacccctcattctcaggc
gatgcaaatctggatttagtagaaatgttgccaaatgacacagagagccgctgtaccagt
ttgagttctattgacaatagtgattttagccagcttcttagtgagtcacaaacatctggg
acactctcagcaggtttacaagagcctgggactagtcaaggtacactcatgtcctatccc
gattccatcgctcggcttatgagcaaccggcccattgaagatgatggtgaagaaagaatt
gacagtgtcctaatgaatggggtttttgatatgcagcagggagtagagtctataacctcc
ttattagaccttgacctctcttctttcatgaacattaaataa

DBGET integrated database retrieval system