KEGG   Xenopus tropicalis (western clawed frog): 407879Help
Entry
407879            CDS       T01011                                 

Gene name
ppp1cc, PP-1G, ppp1g
Definition
(RefSeq) protein phosphatase 1, catalytic subunit, gamma isozyme
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr03015  mRNA surveillance pathway
xtr04114  Oocyte meiosis
xtr04218  Cellular senescence
xtr04261  Adrenergic signaling in cardiomyocytes
xtr04270  Vascular smooth muscle contraction
xtr04510  Focal adhesion
xtr04810  Regulation of actin cytoskeleton
xtr04910  Insulin signaling pathway
xtr05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    407879 (ppp1cc)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    407879 (ppp1cc)
   04218 Cellular senescence
    407879 (ppp1cc)
  Cellular community - eukaryotes
   04510 Focal adhesion
    407879 (ppp1cc)
  Cell motility
   04810 Regulation of actin cytoskeleton
    407879 (ppp1cc)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    407879 (ppp1cc)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    407879 (ppp1cc)
   04270 Vascular smooth muscle contraction
    407879 (ppp1cc)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    407879 (ppp1cc)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     407879 (ppp1cc)
Protein phosphatases and associated proteins [BR:xtr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     407879 (ppp1cc)
Transcription machinery [BR:xtr03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     407879 (ppp1cc)
Messenger RNA biogenesis [BR:xtr03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     407879 (ppp1cc)
Spliceosome [BR:xtr03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    407879 (ppp1cc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N
Motif
Other DBs
NCBI-GeneID: 407879
NCBI-ProteinID: NP_998835
Xenbase: XB-GENE-967934
UniProt: Q6NVU2
Position
1
AA seq 323 aa AA seqDB search
MADVDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNASRPVTPPRGMITKQAKK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgttgacaagcttaacatcgacagcatcatacagcgactgttagaagttaga
ggatcaaaaccgggaaaaaatgttcagcttcaagagaatgagattcgagggctctgtctg
aagtctcgggaaatcttcctcagtcagccaatcttgcttgagcttgaagctcctcttaaa
atatgtggcgatattcatggccagtactatgacttactgcgattatttgaatatggtggt
ttcccacctgaaagcaactacctgttcctaggagactatgtggacagagggaagcagtct
ttagaaacgatctgtcttcttttggcatataaaatcaaatatccagagaacttcttcctc
ctcagaggcaatcatgaatgtgccagcattaacagaatctatggcttttatgatgagtgt
aaaagaagatataatataaagttatggaaaacattcacagattgctttaattgtttgcca
atagctgctatagttgacgagaagatattttgctgtcatggaggtttgtctccagacctt
cagtcgatggagcagatccgacgaattatgcgtcctactgacgttccagaccagggtctt
ctgtgtgacttactttggtctgatcctgacaaagatgtcctagggtggggtgaaaatgac
agaggtgtatcttttacttttggagctgaagtggttgcaaaatttctacacaaacatgat
ctggatctcatttgccgagctcatcaggtggttgaagatgggtatgaattttttgccaag
agacaactggttactttgttctcagccccaaactattgtggagaatttgataatgctgga
gcaatgatgagtgtagatgaaacgttaatgtgttccttccagatcctaaaacctgcagag
aaaaagaagcctaatgcaagcagacctgtaacgccaccacgaggcatgatcacaaaacaa
gcaaagaaataa

DBGET integrated database retrieval system