KEGG   Xenopus tropicalis (western clawed frog): 407893
Entry
407893            CDS       T01011                                 

Gene name
ccno
Definition
(RefSeq) cyclin-O
  KO
K10861  uracil-DNA glycosylase 2 [EC:3.2.2.-]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:xtr03400]
    407893 (ccno)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     407893 (ccno)
DNA repair and recombination proteins [BR:xtr03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     407893 (ccno)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 407893
NCBI-ProteinID: NP_998837
Xenbase: XB-GENE-979545
UniProt: Q6NVR2 A0A7D9NLR5
Position
1
AA seq 353 aa
MVTCSMRCTEERLLGAPLDSGKRKRDSVSPGDATPGDRGEETKRAKYSRHRKQRLELRSC
DSGVADLYETPSPSPVAPCPTYEPWDTCPPMSDRLGLQSFRDYGEGCYLFNKSLEDKFLT
VDCLAHQPQIKAESRCRLISWLIPVHRHLKLGFESLCLAVSILDRFLACTPVASDCFQLV
GVTSLLIACKQVETRPPRVKQLLALCCDAFSREQLCNLECIILLKLHFRLGAPTINFFLQ
HFSLLRVTSMESSDTELSEATKSLTVARGIAELSLADYAFNSYPPSLMAVCCLEIAERML
CHRNPISVRVSGYQESLIQECVGKIDLLVSLNQDSLHRLLPSQFAVRSIKVEN
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggtgacctgtagcatgagatgtacggaggagcggctgctgggagcgccattagactcc
ggcaaaaggaaaagggacagtgtatccccgggggacgccacaccgggtgacagaggagag
gagaccaagagagccaagtattcccggcacaggaagcagagactggagctgaggagctgc
gattccggggtggccgatctgtatgagactccgagcccttccccagtcgccccctgtccg
acctatgagccctgggacacctgcccccccatgtccgatagactcggcctgcagagcttc
cgggactatggggagggctgctacctgttcaacaaaagcctggaagacaagttccttaca
gtggattgcttggctcatcagccccagataaaggcagagtctcgctgtagactcatcagc
tggctgatccctgtacaccgacaccttaaacttggctttgaatccctttgcctcgcagtc
agtatcttggacagattcctcgcctgcacgccagttgcatccgactgcttccagcttgtg
ggtgtcacttctctccttattgcatgcaagcaggtggagacccggcccccacgtgtgaaa
cagctgctcgctctgtgctgtgatgctttttccagggagcagttgtgcaatttggagtgc
atcatccttctcaagctgcacttccgacttggagcccccactataaacttctttctgcag
cacttctctcttctgagagtgaccagtatggaatcctctgacaccgagctgagtgaagcc
accaagtccctaactgttgctagaggcattgcagaactgagcctggcagattatgctttc
aactcctaccctccatccctcatggctgtgtgttgcctggaaatagctgagcgtatgctg
tgccacaggaacccaatcagtgtgcgggtcagtggctatcaggagagcttaatacaggag
tgtgtgggcaagatagacttacttgtctccttaaaccaagactccttgcatcgcctgctg
ccaagtcagtttgctgtcaggagtatcaaagtggaaaactga

DBGET integrated database retrieval system