KEGG   Xenopus tropicalis (western clawed frog): 431676
Entry
431676            CDS       T01011                                 

Symbol
krt8.1
Name
(RefSeq) keratin, type II cytoskeletal 8
  KO
K07605  type II keratin, basic
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:xtr04812]
    431676 (krt8.1)
   04147 Exosome [BR:xtr04147]
    431676 (krt8.1)
Cytoskeleton proteins [BR:xtr04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     431676 (krt8.1)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   431676 (krt8.1)
  Exosomal proteins of other body fluids (saliva and urine)
   431676 (krt8.1)
  Exosomal proteins of colorectal cancer cells
   431676 (krt8.1)
  Exosomal proteins of bladder cancer cells
   431676 (krt8.1)
SSDB
Motif
Pfam: Filament Keratin_2_head ADIP CENP-F_leu_zip Crescentin TPR_MLP1_2 Baculo_PEP_C CALCOCO1 DUF3416 DUF720 DUF5082 DUF3450 DUF1451
Other DBs
NCBI-GeneID: 431676
NCBI-ProteinID: NP_001002797
Xenbase: XB-GENE-876929
UniProt: Q6NVR6
Position
2
AA seq 508 aa
MSIKTTRVTYRTSSAAPRSGGFSSYSYSGAPAASRASTASFSLGSSYGGSSIGGSRFGSG
YRSGFGGAGVGSAGITAVSVNQSLLAPLNLEIDPTIQQVRTEEKEQIKTLNNKFASFIDK
VRFLEQQNKMLETKWSLLQNQKATRSNMDAMFEAYIGNLRRQLDGLGQDKMRLESELGNM
QGLVEDFKNKYEDEINKRTELENEFVLLKKDVDEAYMNKVQLEARLEALTDEINFLRQLY
EEELRELQSQISDTSVVLSMDNNRSLDLDGIIAEVRAQYEDIANKSRLEVESMYQVKYQE
LQASAGRHGDDLKNTKAEISELTRYTTRLQSEIDALKAQRSNLEAQIAEAEERGELALKD
ARTKLAELEAALKNAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGFQN
LSIQTKTVSGVSSGYGGGISSGYGGGISSGYGGGISSGYGGGYSSYSSNVSSLPLETSKT
SKRSIVVKTVETKDGRVLSESSDVFSKP
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgtctatcaaaaccaccagagtcacctaccgcaccagcagcgcagccccccgctccggc
ggcttcagcagctactcgtacagcggggcccccgcagccagcagagccagcactgcctcc
ttcagcctgggatccagctatgggggctccagcattgggggctccaggttcgggagtggc
tacaggagcgggtttgggggtgcaggtgtgggctctgcagggatcacagcggtcagtgtc
aatcagagcctgctggcacccctcaacctggagatcgaccccaccatccagcaggtcagg
accgaggagaaggaacagatcaagactctcaacaacaagttcgcctctttcattgacaag
gtgcgtttcctagaacagcagaacaagatgctagaaaccaagtggagtctcctgcagaac
cagaaggccacacgcagcaacatggacgccatgtttgaggcctacatcggcaacctgagg
cgccagctggatggcctgggccaagacaagatgcgcctggagtctgagctgggaaatatg
cagggcctggtagaggactttaagaacaaatatgaagatgaaatcaacaagcgcacagag
ctggagaatgaatttgtcctgctgaagaaggatgtggatgaggcctatatgaacaaggta
cagctagaggcacgcttggaggccctgacagatgagattaacttcctgcgtcagctgtat
gaagaggagctgcgcgagctgcaatcccagatttccgacacttccgtcgtgctgtctatg
gacaacaaccgcagccttgacctcgatggcatcatcgcagaggtccgagcacagtatgaa
gatattgccaacaagagccgtttagaagtcgagagcatgtatcaagttaagtaccaagaa
ctgcaggcatcagctggtcgccatggtgatgacctgaagaataccaaagccgagattagt
gaactgacccgctacaccacaaggctgcagtctgaaattgatgcactcaaagcacaacgt
tcaaaccttgaggcacagatcgcagaggccgaggaacgtggagagctggcattgaaggat
gccaggaccaagctggctgagctggaggctgctctgaagaatgccaagcaggacatggct
cgccaactgcgcgaataccaggaactgatgaatgtgaaactggcccttgatattgagatt
gccacctacaggaaactgctggaaggagaagagagcagactggaatcaggctttcagaac
ctaagtattcagaccaagactgtatcaggagtttccagtggttacggtggtggaatttcc
agtggttacggtggtggaatttctagtggttacggtggtggaatttccagtggttacggt
ggtggctactcttcctactccagcaatgtgagctctttaccattggagacatccaagaca
agcaagcgtagcattgtagtgaagacagtggagaccaaggatgggagagtgctgtcagaa
tcctcagatgttttctcaaaaccatga

DBGET integrated database retrieval system