KEGG   Xenopus tropicalis (western clawed frog): 448062
Entry
448062            CDS       T01011                                 

Gene name
elavl1
Definition
(RefSeq) ELAV-like protein 1
  KO
K13088  ELAV-like protein 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:xtr03019]
    448062 (elavl1)
   03041 Spliceosome [BR:xtr03041]
    448062 (elavl1)
Messenger RNA biogenesis [BR:xtr03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     448062 (elavl1)
   mRNA cycle factors
    Stress granule specific factors
     448062 (elavl1)
Spliceosome [BR:xtr03041]
 Common components
  Common spliceosomal components
   General mRNP proteins
    448062 (elavl1)
SSDB
Motif
Pfam: RRM_1 RRM_5 BRAP2 RRM_occluded
Other DBs
NCBI-GeneID: 448062
NCBI-ProteinID: NP_001005461
Xenbase: XB-GENE-481800
UniProt: Q6GLB5
Position
1
AA seq 326 aa
MSNGYGDHMDDVCRDDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHS
LGYGFVNYLNAKDAERAINTLNGLRLQSKTIKVSVARPSSESIKDANLYISGLPRTMTQK
DVEDMFLPFGRIINSRVLVDQATGLSRGVAFIRFDKRSEAEEAIASFNGHKPPGSSEPIT
VKFAANPNQNKNMALLSQLCHSPARRFGGPVHHQAQRFRFSPMGVDHMSSISGVNVASSA
SSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAM
AIASLNGYRLGDKTLQVFFKTSKSHK
NT seq 981 nt   +upstreamnt  +downstreamnt
atgtctaacggttatggagaccacatggatgacgtgtgcagggatgacattggtaggacc
aatctaattgtgaactacctgcctcagaatatgacacaagatgaactgcgaagccttttc
agcagtatcggagaggtagaatctgcaaagcttattcgggataaagttgcagggcacagt
ttaggctatggttttgtgaattaccttaatgcaaaagatgcagaaagagcaataaacact
cttaatggcctgaggctgcaatcaaaaactataaaggtctccgttgctcgtccaagttca
gaatccattaaagatgctaatttgtacatcagcgggctcccaaggacaatgacacaaaaa
gatgtagaagatatgtttttaccttttgggcgtattatcaattcaagggtgctggttgat
caggcaacaggtttgtcccggggagttgcctttatacggtttgataaaagatccgaagct
gaagaggccattgccagtttcaatggacacaaaccacctggatcttcagagcctattaca
gtaaaatttgctgccaatccaaatcagaacaagaatatggcccttctttcacagctttgc
cactctccagctcgacgatttggagggcctgtccatcaccaggcacaaaggttcaggttt
tctccaatgggtgtagatcacatgagcagcatatccggtgtaaatgttgcaagcagtgca
tcttctggttggtgcatctttatctacaatcttggccaagatgccgatgaaggaatcctt
tggcaaatgtttgggccttttggagcagtcactaatgtcaaggttattcgtgattttaac
accaacaaatgtaaaggttttggttttgtgaccatgacaaactatgaagaagcagcaatg
gctatcgcaagtcttaatggctaccgtctaggggacaaaaccttacaagttttcttcaaa
accagcaagtcacacaaataa

DBGET integrated database retrieval system