KEGG   Xenopus tropicalis (tropical clawed frog): 448295
Entry
448295            CDS       T01011                                 
Symbol
ubxn6
Name
(RefSeq) UBX domain-containing protein 6
  KO
K14011  UBX domain-containing protein 6
Organism
xtr  Xenopus tropicalis (tropical clawed frog)
Pathway
xtr04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    448295 (ubxn6)
SSDB
Motif
Pfam: PUB UBX
Other DBs
NCBI-GeneID: 448295
NCBI-ProteinID: NP_001005818
Xenbase: XB-GENE-971811
UniProt: Q6DJ18
Position
1:93770744..93786360
AA seq 427 aa
MKKFLDGLKSDIKFKGAGPGHKLSEDTRENVAKVTKEQVKPRKPPTGEAQIAAASAAMAR
MESLQGRTKVQSKDTTTGRKEMIEQKEESNVGPKDIGTTRKKSSSVCTVLFRCPLTDELL
RKEEREGHIRNVLQRLSTTDPTSAAILKIHTYNKDREKVKLGTETIAKYMNNIISHPEEE
KYCRIKLSNKVFQEKISCLEGSHEFFEAVGFEKKTMPGQDLQEEFFVLGGDALKNLDALH
GHCDALLSAEPLRLSLERQLRIFMPSIEAAHFDLPDDFFNLTAEEIKREQRERTEMVERN
AVLRTKAMREREEQREMKKYNYTVLRIKLPDGYILQGIFFARERVSALFDFLREQLQNDW
LPFELLAPGGHKVENEQATLIECGLVPSALLTFRWDEAVMADVEAGGGQSSVSVIKPELL
SKVEQLT
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgaagaaattccttgacggattaaagagtgatataaaattcaagggtgcaggaccggga
cacaaactgagcgaagataccagggaaaatgtggctaaagttacaaaagaacaagttaaa
ccacgtaaacctcccacaggggaggcacagatagcagcggcttctgctgcaatggcgaga
atggaatcgttgcaggggcggaccaaggtgcagtccaaggatacaacaacaggaagaaaa
gagatgattgaacagaaagaagagtctaatgtgggtccaaaggatattggtaccacaaga
aagaagtccagttctgtttgtactgtcctgttcagatgcccactcactgatgaactgctg
aggaaagaggagagggagggccacattagaaatgttttacagaggttgtccaccacagat
cccacatctgctgccattctgaagattcacacatataacaaagacagagaaaaagtgaaa
cttggaactgagactatagctaaatacatgaataatataatcagtcaccctgaagaagag
aagtattgcagaatcaaactgtcaaacaaggtgttccaggagaaaatcagctgtctagag
ggttcccatgaattctttgaggctgttggctttgaaaagaagacaatgcctgggcaagat
ttacaagaagaattttttgttctgggtggtgatgcactgaaaaacctagatgcattacat
gggcattgtgatgcattgctgagtgcagagcctttgagactaagtctggagaggcaattg
cgtattttcatgccatccattgaagctgcacactttgaccttcctgatgactttttcaac
ctgactgcagaagagataaagagggaacaaagagaaaggacagaaatggtggagaggaat
gcagtgctcagaaccaaagcaatgcgagagcgtgaagaacagagagaaatgaagaaatac
aattacactgtgctgagaatcaaattgccagatggatacatcttgcagggcatattcttt
gctcgggaacgggtgtctgctttgtttgattttcttcgtgagcagctgcaaaatgattgg
cttccttttgaacttctggctccagggggtcacaaagtagagaatgagcaggctacattg
atagagtgtgggctggtaccatctgcactactgacctttcgctgggatgaggctgtcatg
gctgatgtggaggctgggggagggcagagttcagtcagtgtaataaagccagagcttctc
tcaaaggtagagcaactcacatag

DBGET integrated database retrieval system